Gene Information

Name : ESA_01051 (ESA_01051)
Accession : YP_001437155.1
Strain : Cronobacter sakazakii ATCC BAA-894
Genome accession: NC_009778
Putative virulence/resistance : Unknown
Product : 50S ribosomal protein L25
Function : -
COG functional category : J : Translation, ribosomal structure and biogenesis
COG ID : COG1825
EC number : -
Position : 1013311 - 1013595 bp
Length : 285 bp
Strand : -
Note : the Ctc family of proteins consists of two types, one that contains the N-terminal ribosomal protein L25 domain only which in Escherichia coli binds the 5S rRNA while a subset of proteins contain a C-terminal extension that is involved in the stress respo

DNA sequence :
ATGTTTACTATCAACGCTGAAGTACGTAAAGAGCAGGGTAAGGGTGCGAGCCGCCGCCTGCGTCACGCCAACAAGTTCCC
GGCTATCGTTTACGGTGGCACCGAGGCTCCGGTTGCAATCGAACTGGACCACGACAAAGTGATGAACATGCAGGCTAAAC
CGGAGTTTTACAGCGAAGTGCTGACTCTGGCTATCGATGGCAAAGAAGTTAAAGTAAAAGTTCAGGCTGTACAGCGTCAC
CCGTACAAACCGAAACTGCACCACATCGACTTCGTTCGCGCGTAA

Protein sequence :
MFTINAEVRKEQGKGASRRLRHANKFPAIVYGGTEAPVAIELDHDKVMNMQAKPEFYSEVLTLAIDGKEVKVKVQAVQRH
PYKPKLHHIDFVRA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
ESA_01051 YP_001437155.1 50S ribosomal protein L25 Not tested Not named Protein 1e-40 100