Gene Information

Name : ESA_01800 (ESA_01800)
Accession : YP_001437890.1
Strain : Cronobacter sakazakii ATCC BAA-894
Genome accession: NC_009778
Putative virulence/resistance : Resistance
Product : hypothetical protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 1739960 - 1740481 bp
Length : 522 bp
Strand : +
Note : COG: COG2310 Uncharacterized proteins involved in stress response, homologs of TerZ and putative cAMP-binding protein CABP1; Psort location: cytoplasmic, score: 23

DNA sequence :
ATGAAAAATGTCCTGGTCGGCCTTGGCTGGGATGCTCGTTCAACTGACGGTCAGGACTTTGACCTGGATGCCTCCGCATT
CATGTTGGCTGCAAACGGCAAAGTGCGCGGCGATTCAGATTTCATCTTCTATAACAACCTGTCATCATCCGACGGTTCCG
TAACGCACACAGGCGATAACCGTACCGGTGAAGGCGATGGTGATGATGAATCGCTGAAAATTAAGCTGGACGCCGTCCCG
TCTGACGTTGACAAGATCATCTTCGTTGTCACTATCCATGATGCTCAGGCTCGTCGCCAGAGCTTTGGTCAGGTATCCGG
TGCGTTTATTCGCTTGGTCAATGACGATAACCAGACTGAAGTCGCTCGCTACGATCTGACCGAAGATGCGTCCACTGAAA
CTGCCATGCTGTTCGGCGAGCTGTATCGACACAATGGTGAGTGGAAATTCCGCGCAGTAGGCCAGGGTTATGCTGGTGGC
CTGGCATCGGTATGTGCTCAGTACGGCATTAACGCGTCCTAA

Protein sequence :
MKNVLVGLGWDARSTDGQDFDLDASAFMLAANGKVRGDSDFIFYNNLSSSDGSVTHTGDNRTGEGDGDDESLKIKLDAVP
SDVDKIIFVVTIHDAQARRQSFGQVSGAFIRLVNDDNQTEVARYDLTEDASTETAMLFGELYRHNGEWKFRAVGQGYAGG
LASVCAQYGINAS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-75 98
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 3e-75 98
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-75 98
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 6e-60 70
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 3e-52 64
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-52 64
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-52 64
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-51 60

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ESA_01800 YP_001437890.1 hypothetical protein BAC0389 Protein 5e-74 96
ESA_01800 YP_001437890.1 hypothetical protein BAC0390 Protein 3e-56 67