Name : ESA_00625 (ESA_00625) Accession : YP_001436745.1 Strain : Cronobacter sakazakii ATCC BAA-894 Genome accession: NC_009778 Putative virulence/resistance : Virulence Product : hypothetical protein Function : - COG functional category : K : Transcription COG ID : COG3311 EC number : - Position : 596545 - 596727 bp Length : 183 bp Strand : - Note : COG: COG3311 Predicted transcriptional regulator; Psort location: cytoplasmic, score: 23 DNA sequence : ATGCGCCTGCCGGAGGTCATTAACATCTGCGGCCTGTCCCGCTCCACTATTTACGACCTAATCTGCCGCGAGCAGTTTCC GTCACAGATTTCGCTGGGCGGCAAGAACGTCGCGTGGCTGGCCTCTGAGATTGATGACTGGATGCAGGCCCGTATCGCTC AGCGTGCCGGAGGTGCGTCATGA Protein sequence : MRLPEVINICGLSRSTIYDLICREQFPSQISLGGKNVAWLASEIDDWMQARIAQRAGGAS |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
VPI2_0041 | ACA01856.1 | predicted transcriptional regulator | Not tested | VPI-2 | Protein | 5e-11 | 46 |
VC1809 | NP_231443.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 7e-11 | 46 |
VC0395_A1406 | YP_001217349.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 7e-11 | 46 |
VC0497 | NP_230151.1 | transcriptional regulator | Not tested | VSP-2 | Protein | 2e-11 | 45 |
PMI2608 | YP_002152324.1 | prophage regulatory protein | Not tested | Not named | Protein | 9e-06 | 45 |
VPI2_0033 | AAX20900.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 7e-08 | 43 |
VC1785 | NP_231420.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 1e-07 | 43 |
VC0395_A1382 | YP_001217325.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 1e-07 | 43 |
unnamed | CAE85187.1 | hypothetical protein | Not tested | PAI V 536 | Protein | 1e-05 | 43 |
S3190 | NP_838473.1 | hypothetical protein | Not tested | SHI-1 | Protein | 8e-06 | 43 |
rox | AAR97599.1 | regulator of excision | Not tested | SHI-1 | Protein | 5e-06 | 43 |
SF2987 | NP_708761.1 | hypothetical protein | Not tested | SHI-1 | Protein | 8e-06 | 43 |
unnamed | CAB46594.1 | DNA-binding protein | Not tested | HPI | Protein | 2e-07 | 42 |
unnamed | CAA21398.1 | - | Not tested | HPI | Protein | 3e-07 | 42 |
ECO103_3577 | YP_003223438.1 | transcriptional regulator | Not tested | LEE | Protein | 2e-05 | 41 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
ESA_00625 | YP_001436745.1 | hypothetical protein | VFG1141 | Protein | 2e-11 | 46 |
ESA_00625 | YP_001436745.1 | hypothetical protein | VFG0651 | Protein | 2e-06 | 43 |
ESA_00625 | YP_001436745.1 | hypothetical protein | VFG1118 | Protein | 3e-08 | 43 |