Name : rpmF (SGO_2065) Accession : YP_001451313.1 Strain : Streptococcus gordonii Challis Genome accession: NC_009785 Putative virulence/resistance : Unknown Product : 50S ribosomal protein L32 Function : - COG functional category : J : Translation, ribosomal structure and biogenesis COG ID : COG0333 EC number : - Position : 2128998 - 2129180 bp Length : 183 bp Strand : + Note : some L32 proteins have zinc finger motifs consisting of CXXC while others do not DNA sequence : ATGGCAGTACCTGCACGTCGCACCTCAAAAGCGAAGAAAAACAAACGTCGTACTCACTACAAAGTAACAGCTCCATCTGT AACTTTTGACGAAACTACTGGAGATTACTCACGTTCTCACCGTGTATCACTTAAAGGATACTACAAAGGACGTAAGATCG CTAAAGCTGCTGCAGCTGAATAA Protein sequence : MAVPARRTSKAKKNKRRTHYKVTAPSVTFDETTGDYSRSHRVSLKGYYKGRKIAKAAAAE |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
ef0071 | AAM75276.1 | EF0071 | Not tested | Not named | Protein | 1e-12 | 67 |
rpmF | NP_814315.1 | 50S ribosomal protein L32 | Not tested | Not named | Protein | 2e-12 | 67 |
rpmF | NP_814351.1 | 50S ribosomal protein L32 | Not tested | Not named | Protein | 1e-13 | 66 |
ef0104 | AAM75307.1 | EF0104 | Not tested | Not named | Protein | 7e-14 | 66 |