|
Name : CKO_00591 (CKO_00591) Accession : YP_001452180.1 Strain : Citrobacter koseri ATCC BAA-895 Genome accession: NC_009792 Putative virulence/resistance : Unknown Product : 50S ribosomal protein L25 Function : - COG functional category : J : Translation, ribosomal structure and biogenesis COG ID : COG1825 EC number : - Position : 569915 - 570199 bp Length : 285 bp Strand : - Note : the Ctc family of proteins consists of two types, one that contains the N-terminal ribosomal protein L25 domain only which in Escherichia coli binds the 5S rRNA while a subset of proteins contain a C-terminal extension that is involved in the stress respo DNA sequence : ATGTTTACTATCAACGCAGAAGTACGTAAAGAGCAGGGTAAGGGTGCGAGCCGCCGCCTGCGCGCCGCTAACAAGTTCCC GGCAATCATCTACGGTGGCGCTGAAGCCCCGATTGCTATCGAACTGGACCACGACCAGGTTATGAACATGCAAGCTAAAG CTGAGTTCTACAGCGAAGTTCTGACCATCGTTGTTGACGGTAAAGAAGTAAAAGTTAAAGCTCAGGCTGTACAGCGTCAC GCGTTCAAGCCAAAGCTGACTCACATCGACTTCGTTCGCGCGTAA Protein sequence : MFTINAEVRKEQGKGASRRLRAANKFPAIIYGGAEAPIAIELDHDQVMNMQAKAEFYSEVLTIVVDGKEVKVKAQAVQRH AFKPKLTHIDFVRA |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| ESA_01051 | YP_001437155.1 | 50S ribosomal protein L25 | Not tested | Not named | Protein | 3e-36 | 87 |
