Gene Information

Name : EcE24377A_4901 (EcE24377A_4901)
Accession : YP_001465829.1
Strain : Escherichia coli E24377A
Genome accession: NC_009801
Putative virulence/resistance : Virulence
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4886085 - 4886576 bp
Length : 492 bp
Strand : +
Note : identified by similarity to GB:ABB64452.1

DNA sequence :
ATGATGAAACTGGCCCTGACACTGGAAGCCGACAGTGTTAACGTACAGGCACTGAATATGGGGCGAATTGTCGTTGACAT
TGATGGTGTTAATCTCGCTGAACTGATTAACATGGTCTGCGATAACGGCTACTCCCTTCGTGTTGTTGATGAATCTGACC
GGACCTCAGCAGACTGCACGCCACCATTTGTTGCCCTTACCGGCATACGCTGCAGTACCGCACATATCACGGAAACGGAC
AACGCCTGGCTGTACTCGCTGTCACACCAGACCAGTGACTTCGGTGAATCAGAATGGATTCATTTTACCGGTACCGGTTA
TCTGTTACGTACCGATGCGTGGTCATACCCGGTTCTGCGGCTTAAGCGCCTGGGGCTGTCAAAAACGTTCCGTCGTCTGG
TCGTCACACTCATCCGGCGTTATGGTGTCAGTCTCATTCATCTGGATGCCAGTGCCGGATATCTGCCGGGTTTACCCACT
TTCGACTGGTAA

Protein sequence :
MMKLALTLEADSVNVQALNMGRIVVDIDGVNLAELINMVCDNGYSLRVVDESDRTSADCTPPFVALTGIRCSTAHITETD
NAWLYSLSHQTSDFGESEWIHFTGTGYLLRTDAWSYPVLRLKRLGLSKTFRRLVVTLIRRYGVSLIHLDASAGYLPGLPT
FDW

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed AAC31487.1 L0008 Not tested LEE Protein 1e-70 98
unnamed ACU09434.1 conserved hypothetical protein Not tested LEE Protein 1e-70 98
Z5092 NP_290243.1 hypothetical protein Not tested LEE Protein 1e-70 98
ECs4540 NP_312567.1 hypothetical protein Not tested LEE Protein 1e-70 98
Z1223 NP_286758.1 hypothetical protein Not tested TAI Protein 2e-69 94
Z1662 NP_287164.1 hypothetical protein Not tested TAI Protein 2e-69 94
unnamed AAL08479.1 unknown Not tested SRL Protein 1e-68 93
unnamed CAD42102.1 hypothetical protein Not tested PAI II 536 Protein 2e-65 92
unnamed CAI43904.1 hypothetical protein Not tested LEE Protein 7e-65 89
yeeW ADD91698.1 YeeW Not tested PAI-I AL862 Protein 2e-62 88
yeeW CAE85205.1 YeeW protein Not tested PAI V 536 Protein 5e-63 88
unnamed AAL57574.1 unknown Not tested LEE Protein 7e-58 88
c5148 NP_756996.1 hypothetical protein Not tested PAI II CFT073 Protein 6e-63 88
z5092 CAD33790.1 Z5092 protein Not tested PAI I 536 Protein 3e-64 88
unnamed CAD66208.1 hypothetical protein Not tested PAI III 536 Protein 5e-65 88
unnamed AAL67388.1 L0008-like protein Not tested PAI II CFT073 Protein 4e-53 88
yeeW CAI43849.1 YeeW protein Not tested LEE Protein 5e-62 85
aec77 AAW51760.1 Aec77 Not tested AGI-3 Protein 9e-60 84
APECO1_3485 YP_854326.1 hypothetical protein Not tested PAI I APEC-O1 Protein 3e-59 84
yeeW NP_838488.1 hypothetical protein Not tested SHI-1 Protein 3e-60 84
yeeW NP_708774.1 hypothetical protein Not tested SHI-1 Protein 3e-60 84
yeeW AAZ04462.1 conserved hypothetical protein Not tested PAI I APEC-O1 Protein 2e-59 84
unnamed AAK00483.1 unknown Not tested SHI-1 Protein 3e-53 82
ECO103_3593 YP_003223450.1 hypothetical protein Not tested LEE Protein 7e-60 81

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
EcE24377A_4901 YP_001465829.1 hypothetical protein VFG0787 Protein 4e-71 98
EcE24377A_4901 YP_001465829.1 hypothetical protein VFG1070 Protein 4e-69 93
EcE24377A_4901 YP_001465829.1 hypothetical protein VFG1621 Protein 7e-66 92
EcE24377A_4901 YP_001465829.1 hypothetical protein VFG1531 Protein 1e-64 88
EcE24377A_4901 YP_001465829.1 hypothetical protein VFG1683 Protein 2e-65 88
EcE24377A_4901 YP_001465829.1 hypothetical protein VFG0664 Protein 9e-61 84