Name : CCC13826_2066 (CCC13826_2066) Accession : YP_001467106.1 Strain : Campylobacter concisus 13826 Genome accession: NC_009802 Putative virulence/resistance : Resistance Product : mercuric transporter periplasmic component Function : - COG functional category : P : Inorganic ion transport and metabolism COG ID : COG2608 EC number : - Position : 1263565 - 1263822 bp Length : 258 bp Strand : - Note : Periplasmic mercury ion-binding protein; Mercury scavenger protein; identified by match to protein family HMM PF00403 DNA sequence : ATGCGTAAAATTTTAGTTTTAGCCCTTCTTGCACTTAGTTGCTACGCTGAGAAAACGATAGAAATTTCAGTGCCTAGCAT GCACTGTCCGCTTTGCACAGCGATAGTTAGAAAGGCCGCACTTAGCGTTGAGGGCGTAAAAAAGGCAGATGTATCGCTAA AAGAGCGAAAAGCTGTCGTTATAGCAGATGACAAGGTCGATGAAAAAGAGCTTTTAAAGGCGGTCGATGCGACTGGCTAT AAAGGCGAGATAAAATAA Protein sequence : MRKILVLALLALSCYAEKTIEISVPSMHCPLCTAIVRKAALSVEGVKKADVSLKERKAVVIADDKVDEKELLKAVDATGY KGEIK |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
unnamed | ABR13399.1 | copper-transporting ATPase 2 | Not tested | PAGI-5 | Protein | 2e-08 | 43 |
merP | CAJ77062.1 | Periplasmic mercuric ion binding protein | Not tested | AbaR1 | Protein | 7e-08 | 43 |
merP | ACN81007.1 | MerP periplasmic mercuric ion binding protein | Not tested | AbaR5 | Protein | 1e-07 | 43 |
merP | AET25399.1 | MerP | Not tested | PAGI-2(C) | Protein | 2e-07 | 41 |
merP | AFG30122.1 | MerP | Not tested | PAGI-2 | Protein | 2e-07 | 41 |
merP | AGK07023.1 | MerP | Not tested | SGI1 | Protein | 2e-07 | 41 |
merP | AGK07081.1 | MerP | Not tested | SGI1 | Protein | 2e-07 | 41 |
merP | YP_006098389.1 | mercuric ion transport protein | Not tested | Tn2411 | Protein | 2e-07 | 41 |
merP | ABQ57373.1 | MerP | Not tested | SGI1 | Protein | 2e-07 | 41 |
merP | AAN62179.1 | periplasmic mercuric ion binding protein MerP | Not tested | PAGI-2(C) | Protein | 5e-08 | 41 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
CCC13826_2066 | YP_001467106.1 | mercuric transporter periplasmic component | BAC0679 | Protein | 3e-08 | 43 |
CCC13826_2066 | YP_001467106.1 | mercuric transporter periplasmic component | BAC0678 | Protein | 2e-08 | 43 |
CCC13826_2066 | YP_001467106.1 | mercuric transporter periplasmic component | BAC0231 | Protein | 2e-08 | 41 |