Gene Information

Name : Franean1_3859 (Franean1_3859)
Accession : YP_001508157.1
Strain : Frankia sp. EAN1.pec
Genome accession: NC_009921
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 4587682 - 4588389 bp
Length : 708 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: fal:FRAAL3821 putative response regulator in two-component regulatory system

DNA sequence :
GTGCGGGTACTGGTCGTGGAGGACGAGGAGCGCACCGCGGACCTGCTCCGCCGGGGCCTTACCGAAGCGGGTTACGCCGT
CGACCTGGTGCACGACGGCACGGACGCGGTCTGGCAGGCCGGCGAGATCTCCTACGACGCCATCGTGCTCGACCTGATGC
TGCCCGGCCTCGACGGCTTCGAGGTCTGCCGCCGGCTCCGGGCGGCCCGGCGGTGGTCCCCGATCCTGATGCTCACCGCC
CGCGGCGACGTCGACGACCGCATCCACGGCCTCGACGCCGGCGCCGACGACTACCTCGCCAAGCCGTTCAGCTTCGGTGA
GCTGACGGCCCGGCTCCGCGCGCTGATCCGCCGCGGTGCCGTCGAGCGGCCGGCCACGCTGCGGGTCGGCGACATCCACC
TCGACCCCGCCGCGCGGAGCGTGCAGCGGGCCGGCGAGCCCGTCGACCTGTCGGCCAAGGAGTTCTCGCTGCTGGAGCTG
CTGATGCGGCGCCCCGGCGAGGTTCTTACCAGGAGCTACATCCTGGATCACATGTGGGACCTCGGCTACGACGGCACGTC
CAACGTGGTCGACCAGTATGTGCGGTACCTGCGCAGGAAGATCGACCCGGCGGACGGCCTGTCGCGCATCGAGACGGTCC
GCGGCGCCGGCTACCGCCTCCGCACCGAGACCACCGACACAGCCGACACAGCCGAGACGGGGACGTAG

Protein sequence :
MRVLVVEDEERTADLLRRGLTEAGYAVDLVHDGTDAVWQAGEISYDAIVLDLMLPGLDGFEVCRRLRAARRWSPILMLTA
RGDVDDRIHGLDAGADDYLAKPFSFGELTARLRALIRRGAVERPATLRVGDIHLDPAARSVQRAGEPVDLSAKEFSLLEL
LMRRPGEVLTRSYILDHMWDLGYDGTSNVVDQYVRYLRRKIDPADGLSRIETVRGAGYRLRTETTDTADTAETGT

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-41 48
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 6e-42 48

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Franean1_3859 YP_001508157.1 two component transcriptional regulator BAC0083 Protein 5e-49 52
Franean1_3859 YP_001508157.1 two component transcriptional regulator BAC0197 Protein 8e-48 52
Franean1_3859 YP_001508157.1 two component transcriptional regulator BAC0638 Protein 1e-38 49
Franean1_3859 YP_001508157.1 two component transcriptional regulator BAC0125 Protein 6e-47 48
Franean1_3859 YP_001508157.1 two component transcriptional regulator BAC0111 Protein 4e-47 48
Franean1_3859 YP_001508157.1 two component transcriptional regulator BAC0308 Protein 6e-44 47
Franean1_3859 YP_001508157.1 two component transcriptional regulator BAC0347 Protein 1e-41 45
Franean1_3859 YP_001508157.1 two component transcriptional regulator HE999704.1.gene1528. Protein 3e-35 44
Franean1_3859 YP_001508157.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 2e-39 43
Franean1_3859 YP_001508157.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 2e-39 43
Franean1_3859 YP_001508157.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 2e-39 43
Franean1_3859 YP_001508157.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 2e-39 43
Franean1_3859 YP_001508157.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 2e-39 43
Franean1_3859 YP_001508157.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 2e-39 43
Franean1_3859 YP_001508157.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 2e-39 43
Franean1_3859 YP_001508157.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 2e-39 43
Franean1_3859 YP_001508157.1 two component transcriptional regulator AE015929.1.gene1106. Protein 1e-34 41
Franean1_3859 YP_001508157.1 two component transcriptional regulator Y16952.3.orf35.gene. Protein 2e-21 41
Franean1_3859 YP_001508157.1 two component transcriptional regulator NC_002516.2.879194.p Protein 6e-33 41
Franean1_3859 YP_001508157.1 two component transcriptional regulator U82965.2.orf14.gene. Protein 2e-25 41
Franean1_3859 YP_001508157.1 two component transcriptional regulator AE000516.2.gene3505. Protein 3e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Franean1_3859 YP_001508157.1 two component transcriptional regulator VFG1390 Protein 7e-48 49
Franean1_3859 YP_001508157.1 two component transcriptional regulator VFG0596 Protein 4e-42 48
Franean1_3859 YP_001508157.1 two component transcriptional regulator VFG1386 Protein 6e-41 46
Franean1_3859 YP_001508157.1 two component transcriptional regulator VFG1389 Protein 2e-37 44