Gene Information

Name : Clos_1734 (Clos_1734)
Accession : YP_001513270.1
Strain : Alkaliphilus oremlandii OhILAs
Genome accession: NC_009922
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1835588 - 1836277 bp
Length : 690 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: tte:TTE0481 response regulators consisting of a CheY-like receiver domain and a HTH DNA-binding domain

DNA sequence :
ATGGGATATAAAATTTTAATTGTAGATGATGAACCCTTATTAGTAAAAGGCTTGAAGTATAGCCTAGAGCAGGATGGATA
TGAAATACTAACGGCATTTGATGGAGAAGAGGCTTTAGAGAAAGCAAAAATAGCAAATGCGGATTTGATATTGCTAGATT
TAATGCTTCCGAAAATCGATGGACTCCAAGTTTGTCAACAAATAAGATTAAATTCACAAACGCCAATTATCATGTTGACG
GCAAAAGGGGAGGATATGAGCAAGATCTTAGGATTAGAATACGGTGCAGATGATTATCTAACAAAGCCTTTTAATATCTT
AGAATTAAAGGCTAGAATTAAAGCGGTCTTAAGAAGATACCAAAGTTCAGACAAGCCCATTGAAGAGAGAGTCATTAAAA
TTGATGACTTTAAAATTAATACACTGGGCAGGAAAGTAAGCTTAAAGGGAGAAGAAGTGAATCTTACTGCGAAAGAGTTC
GATCTTCTGCTGCTATTGGCTTCTAATCCTGGAAAGATCTATAGCAGAGAAGAATTGTTGGAGATCATTTGGGGCTATGA
ATACTTTGGTGATTTACGTACAGTTGATGTTCATATTCGAAGATTAAGAGAAAAAATAGAAATTAATTCAAGCAACCCAG
AGTATATACTTACAAAGTGGGGAGTGGGGTATTATTTTAGGAATAAATAG

Protein sequence :
MGYKILIVDDEPLLVKGLKYSLEQDGYEILTAFDGEEALEKAKIANADLILLDLMLPKIDGLQVCQQIRLNSQTPIIMLT
AKGEDMSKILGLEYGADDYLTKPFNILELKARIKAVLRRYQSSDKPIEERVIKIDDFKINTLGRKVSLKGEEVNLTAKEF
DLLLLLASNPGKIYSREELLEIIWGYEYFGDLRTVDVHIRRLREKIEINSSNPEYILTKWGVGYYFRNK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-39 43
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-39 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Clos_1734 YP_001513270.1 two component transcriptional regulator NC_012469.1.7685629. Protein 7e-55 54
Clos_1734 YP_001513270.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 3e-47 49
Clos_1734 YP_001513270.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 2e-47 49
Clos_1734 YP_001513270.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 2e-47 49
Clos_1734 YP_001513270.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 2e-47 49
Clos_1734 YP_001513270.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 2e-47 49
Clos_1734 YP_001513270.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 2e-47 49
Clos_1734 YP_001513270.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 3e-47 49
Clos_1734 YP_001513270.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 2e-47 49
Clos_1734 YP_001513270.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 2e-47 49
Clos_1734 YP_001513270.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 3e-47 48
Clos_1734 YP_001513270.1 two component transcriptional regulator HE999704.1.gene2815. Protein 3e-47 48
Clos_1734 YP_001513270.1 two component transcriptional regulator AM180355.1.gene1830. Protein 3e-42 47
Clos_1734 YP_001513270.1 two component transcriptional regulator DQ212986.1.gene4.p01 Protein 5e-40 46
Clos_1734 YP_001513270.1 two component transcriptional regulator NC_014475.1.orf0.gen Protein 6e-40 46
Clos_1734 YP_001513270.1 two component transcriptional regulator NC_005054.2598277.p0 Protein 6e-40 46
Clos_1734 YP_001513270.1 two component transcriptional regulator NC_012469.1.7686381. Protein 2e-40 45
Clos_1734 YP_001513270.1 two component transcriptional regulator AF130997.1.orf0.gene Protein 1e-37 45
Clos_1734 YP_001513270.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 7e-40 44
Clos_1734 YP_001513270.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 7e-40 44
Clos_1734 YP_001513270.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 7e-40 44
Clos_1734 YP_001513270.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 7e-40 44
Clos_1734 YP_001513270.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 7e-40 44
Clos_1734 YP_001513270.1 two component transcriptional regulator AE015929.1.gene1106. Protein 3e-33 44
Clos_1734 YP_001513270.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 7e-40 44
Clos_1734 YP_001513270.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 7e-40 44
Clos_1734 YP_001513270.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 7e-40 44
Clos_1734 YP_001513270.1 two component transcriptional regulator FJ349556.1.orf0.gene Protein 9e-41 44
Clos_1734 YP_001513270.1 two component transcriptional regulator AE000516.2.gene3505. Protein 3e-41 44
Clos_1734 YP_001513270.1 two component transcriptional regulator CP004022.1.gene3215. Protein 5e-31 43
Clos_1734 YP_001513270.1 two component transcriptional regulator CP000034.1.gene3671. Protein 2e-37 43
Clos_1734 YP_001513270.1 two component transcriptional regulator AF162694.1.orf4.gene Protein 4e-35 42
Clos_1734 YP_001513270.1 two component transcriptional regulator EU250284.1.orf4.gene Protein 1e-35 42
Clos_1734 YP_001513270.1 two component transcriptional regulator AE016830.1.gene1681. Protein 8e-41 42
Clos_1734 YP_001513270.1 two component transcriptional regulator AF155139.2.orf0.gene Protein 4e-41 42
Clos_1734 YP_001513270.1 two component transcriptional regulator CP000675.2.gene1535. Protein 3e-34 41
Clos_1734 YP_001513270.1 two component transcriptional regulator CP001581.1.gene280.p Protein 1e-33 41
Clos_1734 YP_001513270.1 two component transcriptional regulator CP001138.1.gene4273. Protein 1e-27 41
Clos_1734 YP_001513270.1 two component transcriptional regulator CP001918.1.gene3444. Protein 3e-31 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Clos_1734 YP_001513270.1 two component transcriptional regulator VFG1563 Protein 9e-40 43
Clos_1734 YP_001513270.1 two component transcriptional regulator VFG1702 Protein 6e-40 43