Gene Information

Name : Sare_1090 (Sare_1090)
Accession : YP_001535989.1
Strain : Salinispora arenicola CNS-205
Genome accession: NC_009953
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1227976 - 1228668 bp
Length : 693 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: stp:Strop_1197 response regulator receiver

DNA sequence :
GTGACGCAACGGGTGCTGGTCGTCGACGACGACCGAACGGTGAGCGACGTGGTCTGTCGCTACCTGGAGCATGCCGGCTA
CCAGGTGCGGCACGTCGGCGACGGCGGAGCGGCGCTCGCCGCGGTCGCCGCTGAGCCGCCGGACCTCGTCGTGCTGGATC
TGATGCTGCCCGGAGTCGACGGCCTGGAGGTCTGCCGCCGGCTGCGCGCCCAGCCCGGCGGGATACCCATCATCATGCTC
ACCGCCCGCGGCGACGAGGCCGACCGGGTCCTCGGCCTGCAACTCGGTGCGGACGACTACCTCAGCAAGCCGTTCTCGCC
CCGGGAACTGGTGCTGCGGGTCGGGTCGGTGCTTCGGCGCAGCGGTGGGCCCCGTGCGGCGCCGGCCACCGTGCTCCGCG
ACGGCGCGCTCGTGGTCGAGACGGGCCCTCGGGTGGCCCGGCTGCACGGCCACGAGCTGACCCTCACCGTACGCGAGTTC
GACCTGCTGGCGTACCTGATGCGACACCCCGTGCGGGCGTTCCGCCGGGCCGAGTTGCTGGAGCGGGTGTGGGGGTGGAA
CTTCGGTGACCAGTCGACGGTGACCGTCCACGTCCGACGGTTACGCGAGAAGGTGGAGGCCGACCCGGCCAACCCACGCC
GGATCGTGACGGTCTGGGGCATTGGCTACCGTTACGAGCCGACCGATGCGTGA

Protein sequence :
MTQRVLVVDDDRTVSDVVCRYLEHAGYQVRHVGDGGAALAAVAAEPPDLVVLDLMLPGVDGLEVCRRLRAQPGGIPIIML
TARGDEADRVLGLQLGADDYLSKPFSPRELVLRVGSVLRRSGGPRAAPATVLRDGALVVETGPRVARLHGHELTLTVREF
DLLAYLMRHPVRAFRRAELLERVWGWNFGDQSTVTVHVRRLREKVEADPANPRRIVTVWGIGYRYEPTDA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 8e-31 43
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-31 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Sare_1090 YP_001535989.1 two component transcriptional regulator AE000516.2.gene3505. Protein 3e-28 48
Sare_1090 YP_001535989.1 two component transcriptional regulator NC_012469.1.7686381. Protein 7e-35 47
Sare_1090 YP_001535989.1 two component transcriptional regulator NC_012469.1.7685629. Protein 9e-30 46
Sare_1090 YP_001535989.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 5e-31 44
Sare_1090 YP_001535989.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 5e-31 44
Sare_1090 YP_001535989.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 5e-31 44
Sare_1090 YP_001535989.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 5e-31 44
Sare_1090 YP_001535989.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 5e-31 44
Sare_1090 YP_001535989.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 5e-31 44
Sare_1090 YP_001535989.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 5e-31 44
Sare_1090 YP_001535989.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 5e-31 44
Sare_1090 YP_001535989.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 5e-31 44
Sare_1090 YP_001535989.1 two component transcriptional regulator CP000034.1.gene3671. Protein 9e-32 43
Sare_1090 YP_001535989.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 5e-31 43
Sare_1090 YP_001535989.1 two component transcriptional regulator HE999704.1.gene1528. Protein 2e-19 43
Sare_1090 YP_001535989.1 two component transcriptional regulator BAC0125 Protein 1e-18 41
Sare_1090 YP_001535989.1 two component transcriptional regulator FJ349556.1.orf0.gene Protein 3e-27 41
Sare_1090 YP_001535989.1 two component transcriptional regulator HE999704.1.gene2815. Protein 6e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Sare_1090 YP_001535989.1 two component transcriptional regulator VFG1702 Protein 3e-31 43
Sare_1090 YP_001535989.1 two component transcriptional regulator VFG1563 Protein 8e-32 42
Sare_1090 YP_001535989.1 two component transcriptional regulator VFG1390 Protein 1e-24 42