Gene Information

Name : Sare_0904 (Sare_0904)
Accession : YP_001535812.1
Strain : Salinispora arenicola CNS-205
Genome accession: NC_009953
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1016574 - 1017263 bp
Length : 690 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: stp:Strop_0967 response regulator receiver

DNA sequence :
ATGAGAGCACGGGTACTGGTGGTTGACGACGACCCCGCCCTCGCCGAGATGCTCGGCATCGTCCTGCGAAGCGAGGGTTT
CCTGCCCTCGTTCGTGGCGGATGGTGAACGTGCCCTGGCCGCGTTCCGGGAGAGCCGGCCGGACATTGTGCTGCTCGACC
TCATGTTGCCGGGAATGAGCGGCATCGACGTGGCCCGGTCTATCCGGGGCGAGTCGGGCGTGCCGATCGTCATGCTGACC
GCCAAGAGCGACACGGTTGACGTCGTCCTCGGTTTGGAGTCCGGGGCCGACGACTACGTGGTCAAGCCCTTCAAGCCGAA
GGAGCTGGTGGCCCGGATGCGGGCCCGGCTGCGCCGGGGCGAGGATGCGGCCCCGGAACTGCTCACCATTGGGCCCACGG
GCAACCAGATCACCATCGACGTGCCGGCGCACACCGTCAGCCGTAACGGTGAGGAGGTGAAGCTCACGCCGCTGGAGTTC
GACCTCCTGGTCGCCCTCGCGCGCAAGCCGCGTCAGGTCTTCACCCGCGAGGTGCTGCTGGAGCAGGTCTGGGGATACCG
GCATGCGGCGGACACTCGCCTGGTCAACGTGCATGTCCAGCGGCTACGGGCCAAGATCGAGCCGGATCCGGAGCGCCCGG
AAATTATCCTCACCGTGCGTGGCGTGGGCTACAAGGCGGGTACCGGATAA

Protein sequence :
MRARVLVVDDDPALAEMLGIVLRSEGFLPSFVADGERALAAFRESRPDIVLLDLMLPGMSGIDVARSIRGESGVPIVMLT
AKSDTVDVVLGLESGADDYVVKPFKPKELVARMRARLRRGEDAAPELLTIGPTGNQITIDVPAHTVSRNGEEVKLTPLEF
DLLVALARKPRQVFTREVLLEQVWGYRHAADTRLVNVHVQRLRAKIEPDPERPEIILTVRGVGYKAGTG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 3e-38 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-38 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Sare_0904 YP_001535812.1 two component transcriptional regulator AE000516.2.gene3505. Protein 4e-78 76
Sare_0904 YP_001535812.1 two component transcriptional regulator NC_012469.1.7685629. Protein 2e-44 47
Sare_0904 YP_001535812.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 2e-42 44
Sare_0904 YP_001535812.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 3e-42 44
Sare_0904 YP_001535812.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 2e-42 44
Sare_0904 YP_001535812.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 3e-42 44
Sare_0904 YP_001535812.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 3e-42 44
Sare_0904 YP_001535812.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 3e-42 44
Sare_0904 YP_001535812.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 3e-42 44
Sare_0904 YP_001535812.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 3e-42 44
Sare_0904 YP_001535812.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 3e-42 44
Sare_0904 YP_001535812.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 2e-42 44
Sare_0904 YP_001535812.1 two component transcriptional regulator NC_012469.1.7686381. Protein 4e-41 43
Sare_0904 YP_001535812.1 two component transcriptional regulator BAC0125 Protein 3e-33 43
Sare_0904 YP_001535812.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 5e-38 42
Sare_0904 YP_001535812.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 5e-38 42
Sare_0904 YP_001535812.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 5e-38 42
Sare_0904 YP_001535812.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 5e-38 42
Sare_0904 YP_001535812.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 5e-38 42
Sare_0904 YP_001535812.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 5e-38 42
Sare_0904 YP_001535812.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 5e-38 42
Sare_0904 YP_001535812.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 5e-38 42
Sare_0904 YP_001535812.1 two component transcriptional regulator HE999704.1.gene2815. Protein 4e-40 42
Sare_0904 YP_001535812.1 two component transcriptional regulator AE015929.1.gene1106. Protein 5e-33 41
Sare_0904 YP_001535812.1 two component transcriptional regulator AE016830.1.gene1681. Protein 2e-42 41
Sare_0904 YP_001535812.1 two component transcriptional regulator BAC0039 Protein 4e-39 41
Sare_0904 YP_001535812.1 two component transcriptional regulator BAC0596 Protein 4e-39 41
Sare_0904 YP_001535812.1 two component transcriptional regulator NC_002695.1.916589.p Protein 3e-39 41
Sare_0904 YP_001535812.1 two component transcriptional regulator CP000034.1.gene2186. Protein 4e-39 41
Sare_0904 YP_001535812.1 two component transcriptional regulator CP001138.1.gene2239. Protein 4e-39 41
Sare_0904 YP_001535812.1 two component transcriptional regulator CP001918.1.gene3444. Protein 3e-39 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Sare_0904 YP_001535812.1 two component transcriptional regulator VFG1389 Protein 1e-31 44
Sare_0904 YP_001535812.1 two component transcriptional regulator VFG1390 Protein 2e-33 43
Sare_0904 YP_001535812.1 two component transcriptional regulator VFG1563 Protein 1e-38 41
Sare_0904 YP_001535812.1 two component transcriptional regulator VFG1702 Protein 9e-39 41