Gene Information

Name : Haur_4663 (Haur_4663)
Accession : YP_001547422.1
Strain : Herpetosiphon aurantiacus DSM 785
Genome accession: NC_009972
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 5960675 - 5961373 bp
Length : 699 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: sco:SCO3741 response regulator

DNA sequence :
ATGGCCAATATTTTGGTGGTTGATGACGAACCGAATATTCGCGAAGTGGTAGGCTTGTATTTGCGGCGCGAAGGCCATAC
GGTGCTTGAGGCCAGCGATGGCGAGGCCGCTTTGCGCTTGGCGCGTCAGCAACCACCCGATTTGGTCGTGCTTGATCTGA
TGTTGCCCAAAGTGACTGGCTTAGAAGTTTGTCGGCGCTTGCAGAGCGATCGCCGCACGCCAGTGATTATGCTCACCGCC
AAGAGCGAGGAGAACGATCGCATCATTGGCCTCGGGGTTGGTGCTGATGATTATGTGGTCAAGCCATTTAGCCCACGCGA
ATTGGTGGCCCGGGTGGAAGCGGTGTTGCGCCGTGTTCAGCCGCAGCCCGATGCTCCACCACCCGACGAACGCCCAATTG
AACTTGGCGCACTGCGGGTCGATCCGCGCACTCGTGATGTGCAAGTGGCGGGCAAATCGATCAGCCTAACTGCGCGTGAG
TTTGATTTGCTCTATTTTTTGGCACGCCATCGCGAGCGTGTGTTTACCCGCGACCAACTGATGGAACTCGTTTGGGGCTA
TACATTTTCTGCCGATACCAGCACCGTGACGGTGCATATTCGGCGCTTGCGCGAAAAAATCGAAGACGATCCGACTGCCC
CGCGTTATTTGCAAACAGTTTGGGGCGTGGGCTACAAACTCAGCGCAGGCGAACAATGA

Protein sequence :
MANILVVDDEPNIREVVGLYLRREGHTVLEASDGEAALRLARQQPPDLVVLDLMLPKVTGLEVCRRLQSDRRTPVIMLTA
KSEENDRIIGLGVGADDYVVKPFSPRELVARVEAVLRRVQPQPDAPPPDERPIELGALRVDPRTRDVQVAGKSISLTARE
FDLLYFLARHRERVFTRDQLMELVWGYTFSADTSTVTVHIRRLREKIEDDPTAPRYLQTVWGVGYKLSAGEQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 4e-30 43
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-30 43
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-20 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Haur_4663 YP_001547422.1 two component transcriptional regulator AE000516.2.gene3505. Protein 2e-32 49
Haur_4663 YP_001547422.1 two component transcriptional regulator NC_012469.1.7685629. Protein 4e-34 47
Haur_4663 YP_001547422.1 two component transcriptional regulator NC_012469.1.7686381. Protein 2e-34 45
Haur_4663 YP_001547422.1 two component transcriptional regulator CP000034.1.gene3671. Protein 3e-30 45
Haur_4663 YP_001547422.1 two component transcriptional regulator HE999704.1.gene2815. Protein 2e-36 44
Haur_4663 YP_001547422.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 9e-33 44
Haur_4663 YP_001547422.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 1e-32 44
Haur_4663 YP_001547422.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 1e-32 44
Haur_4663 YP_001547422.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 1e-32 44
Haur_4663 YP_001547422.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 1e-32 44
Haur_4663 YP_001547422.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 1e-32 44
Haur_4663 YP_001547422.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 1e-32 44
Haur_4663 YP_001547422.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 1e-32 44
Haur_4663 YP_001547422.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 1e-32 44
Haur_4663 YP_001547422.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 8e-33 44
Haur_4663 YP_001547422.1 two component transcriptional regulator AE016830.1.gene1681. Protein 1e-34 43
Haur_4663 YP_001547422.1 two component transcriptional regulator NC_005054.2598277.p0 Protein 2e-32 42
Haur_4663 YP_001547422.1 two component transcriptional regulator NC_014475.1.orf0.gen Protein 2e-32 42
Haur_4663 YP_001547422.1 two component transcriptional regulator AF155139.2.orf0.gene Protein 5e-37 42
Haur_4663 YP_001547422.1 two component transcriptional regulator EU250284.1.orf4.gene Protein 6e-26 41
Haur_4663 YP_001547422.1 two component transcriptional regulator CP000647.1.gene2531. Protein 4e-20 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Haur_4663 YP_001547422.1 two component transcriptional regulator VFG1389 Protein 2e-25 44
Haur_4663 YP_001547422.1 two component transcriptional regulator VFG1563 Protein 2e-30 43
Haur_4663 YP_001547422.1 two component transcriptional regulator VFG1702 Protein 8e-31 43
Haur_4663 YP_001547422.1 two component transcriptional regulator VFG0596 Protein 2e-20 41