Gene Information

Name : Cphy_0015 (Cphy_0015)
Accession : YP_001557145.1
Strain : Clostridium phytofermentans ISDg
Genome accession: NC_010001
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 26532 - 27218 bp
Length : 687 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: amt:Amet_1506 two component transcriptional regulator, winged helix family

DNA sequence :
ATGGCGAAGATATTAATTGTTGAGGATGAAGTTAAGATCGCTAGATTTGTAGAACTTGAACTTAAGTATGAGGGTTATAC
GGTTGATATTGCAAATGATGGTAGATCAGGCCTTGAAAAGGCTCTAAAGTCAGACATTGATTTAGTATTGTTAGATGTTA
TGCTTCCTGGGTTAAGCGGTATTGAAGTGTGTAGAAGAATACGTATGGAGTCTCAGGTACCAATTATTATGTTAACAGCG
AAGGATGATGTCACGGATAAAGTAGCTGGTCTTGATATGGGCGCCGATGATTATATGACGAAACCTTTTGCTATTGAGGA
GCTTTTAGCTAGAATTCGTGTGGCACTCAGCAGACATAGTAAGAGTAGTGCAGAAGCAAAACAGGATGTATTAACTCATG
GTGAACTTAAATTAAACCTAACAAGCCATAGTGCTAATTATGGGGAGGAAGATTTAACTCTCACAAAAAAAGAATACGAA
TTGTTAGAGTATTTAATGAGAAATAAAAATATAGCGCTAACAAGGGAACAATTATTAAATAATGTATGGGACTATGAATA
TTTTGGAGATACCAATGTAGTAGATGTATATATTCGTTATCTTAGACAAAAAATTGATGATAAGTATGGAGTGCATTTAA
TAAGTACAGTTCGAGGGGTGGGATATATAATTCGAGATGAAAAATAG

Protein sequence :
MAKILIVEDEVKIARFVELELKYEGYTVDIANDGRSGLEKALKSDIDLVLLDVMLPGLSGIEVCRRIRMESQVPIIMLTA
KDDVTDKVAGLDMGADDYMTKPFAIEELLARIRVALSRHSKSSAEAKQDVLTHGELKLNLTSHSANYGEEDLTLTKKEYE
LLEYLMRNKNIALTREQLLNNVWDYEYFGDTNVVDVYIRYLRQKIDDKYGVHLISTVRGVGYIIRDEK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-31 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cphy_0015 YP_001557145.1 two component transcriptional regulator HE999704.1.gene1528. Protein 1e-43 57
Cphy_0015 YP_001557145.1 two component transcriptional regulator AE015929.1.gene1106. Protein 3e-41 50
Cphy_0015 YP_001557145.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 3e-43 49
Cphy_0015 YP_001557145.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 3e-43 49
Cphy_0015 YP_001557145.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 3e-43 49
Cphy_0015 YP_001557145.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 3e-43 49
Cphy_0015 YP_001557145.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 3e-43 49
Cphy_0015 YP_001557145.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 3e-43 49
Cphy_0015 YP_001557145.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 3e-43 49
Cphy_0015 YP_001557145.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 3e-43 49
Cphy_0015 YP_001557145.1 two component transcriptional regulator NC_005054.2598277.p0 Protein 3e-33 45
Cphy_0015 YP_001557145.1 two component transcriptional regulator NC_014475.1.orf0.gen Protein 3e-33 45
Cphy_0015 YP_001557145.1 two component transcriptional regulator BAC0197 Protein 4e-34 45
Cphy_0015 YP_001557145.1 two component transcriptional regulator BAC0308 Protein 2e-32 44
Cphy_0015 YP_001557145.1 two component transcriptional regulator BAC0125 Protein 1e-35 44
Cphy_0015 YP_001557145.1 two component transcriptional regulator BAC0083 Protein 9e-37 43
Cphy_0015 YP_001557145.1 two component transcriptional regulator NC_012469.1.7685629. Protein 8e-34 42
Cphy_0015 YP_001557145.1 two component transcriptional regulator NC_012469.1.7686381. Protein 3e-33 41
Cphy_0015 YP_001557145.1 two component transcriptional regulator BAC0111 Protein 5e-32 41
Cphy_0015 YP_001557145.1 two component transcriptional regulator BAC0638 Protein 4e-33 41
Cphy_0015 YP_001557145.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 4e-32 41
Cphy_0015 YP_001557145.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 3e-32 41
Cphy_0015 YP_001557145.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 4e-32 41
Cphy_0015 YP_001557145.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 4e-32 41
Cphy_0015 YP_001557145.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 3e-32 41
Cphy_0015 YP_001557145.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 4e-32 41
Cphy_0015 YP_001557145.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 4e-32 41
Cphy_0015 YP_001557145.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 4e-32 41
Cphy_0015 YP_001557145.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 4e-32 41
Cphy_0015 YP_001557145.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 4e-32 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cphy_0015 YP_001557145.1 two component transcriptional regulator VFG1390 Protein 2e-39 42
Cphy_0015 YP_001557145.1 two component transcriptional regulator VFG0473 Protein 4e-21 41
Cphy_0015 YP_001557145.1 two component transcriptional regulator VFG0596 Protein 2e-31 41
Cphy_0015 YP_001557145.1 two component transcriptional regulator VFG1389 Protein 4e-34 41