Gene Information

Name : Daci_1713 (Daci_1713)
Accession : YP_001562741.1
Strain : Delftia acidovorans SPH-1
Genome accession: NC_010002
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1905266 - 1905949 bp
Length : 684 bp
Strand : -
Note : TIGRFAM: heavy metal response regulator; PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: mpt:Mpe_A1629 two-component response regulator

DNA sequence :
ATGAGAATCCTAATAATTGAGGATGATGAAAAGTTGGTAGACCAGCTTGTCAGAGGGTTGGACGACGAAGGGTTTACTGT
AGATTTTGCACTTGATGGGATCTCAGGACTAAATAAGGCGGCTACCCAGGATTTCGATGTAATTATTCTTGATGGCATGC
TTCCTGGAATAGATGGCCTTGCTGTTTTAGCGGCTTTGAGACAGTCAAAGCAAACAGCTGTTTTGATGCTCACTGCAAGA
GATTCAGTTGAAGACAGAGTGACCGGCTTGAAAAGCGGTGCTGATGACTATATGGTCAAGCCGTTTGCATTTTCCGAATT
GGTCGCAAGAATAAAGGTATTGCTCCGCAGGAATCCTTCATTGAGCAGTGCGGTGAATGTTGCGACAATATTGAGAATGC
ACGACTTGGAAATAGATCTTGCAAGGCAGCGTGCCTTTCGTGCGGGGAAAAAACTCGATCTAAGTGCGAAAGAGTATAGC
TTGCTGATATTGTTGATACGTAGACAAGGAGAGGTGATTTCTCGAGCTGAGCTAGCCTCTCAGGTCTGGTCAATAAATTT
TGAGTCAGAGTCAAATGTCGTTGAGGTGGCCATTAGAAGGCTAAGAATGAAAATCGATGAGCCGTTCGATAAGCCATTGC
TGCACACCATTCGCGGAATGGGCTACATTTTGGAATCAAGATGA

Protein sequence :
MRILIIEDDEKLVDQLVRGLDDEGFTVDFALDGISGLNKAATQDFDVIILDGMLPGIDGLAVLAALRQSKQTAVLMLTAR
DSVEDRVTGLKSGADDYMVKPFAFSELVARIKVLLRRNPSLSSAVNVATILRMHDLEIDLARQRAFRAGKKLDLSAKEYS
LLILLIRRQGEVISRAELASQVWSINFESESNVVEVAIRRLRMKIDEPFDKPLLHTIRGMGYILESR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-55 51
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-55 51

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Daci_1713 YP_001562741.1 two component heavy metal response transcriptional regulator BAC0197 Protein 5e-60 55
Daci_1713 YP_001562741.1 two component heavy metal response transcriptional regulator BAC0083 Protein 5e-56 54
Daci_1713 YP_001562741.1 two component heavy metal response transcriptional regulator BAC0125 Protein 3e-58 52
Daci_1713 YP_001562741.1 two component heavy metal response transcriptional regulator BAC0638 Protein 2e-48 52
Daci_1713 YP_001562741.1 two component heavy metal response transcriptional regulator BAC0308 Protein 1e-52 49
Daci_1713 YP_001562741.1 two component heavy metal response transcriptional regulator BAC0111 Protein 2e-51 47
Daci_1713 YP_001562741.1 two component heavy metal response transcriptional regulator BAC0347 Protein 2e-46 45
Daci_1713 YP_001562741.1 two component heavy metal response transcriptional regulator HE999704.1.gene1528. Protein 1e-31 42
Daci_1713 YP_001562741.1 two component heavy metal response transcriptional regulator NC_002758.1121390.p0 Protein 4e-37 41
Daci_1713 YP_001562741.1 two component heavy metal response transcriptional regulator NC_010079.5776364.p0 Protein 4e-37 41
Daci_1713 YP_001562741.1 two component heavy metal response transcriptional regulator NC_002952.2859858.p0 Protein 4e-37 41
Daci_1713 YP_001562741.1 two component heavy metal response transcriptional regulator NC_007622.3794948.p0 Protein 4e-37 41
Daci_1713 YP_001562741.1 two component heavy metal response transcriptional regulator NC_003923.1003417.p0 Protein 4e-37 41
Daci_1713 YP_001562741.1 two component heavy metal response transcriptional regulator NC_013450.8614146.p0 Protein 4e-37 41
Daci_1713 YP_001562741.1 two component heavy metal response transcriptional regulator NC_002951.3238224.p0 Protein 4e-37 41
Daci_1713 YP_001562741.1 two component heavy metal response transcriptional regulator NC_007793.3914065.p0 Protein 4e-37 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Daci_1713 YP_001562741.1 two component heavy metal response transcriptional regulator VFG0596 Protein 7e-56 51
Daci_1713 YP_001562741.1 two component heavy metal response transcriptional regulator VFG1389 Protein 3e-37 43