Gene Information

Name : Daci_0484 (Daci_0484)
Accession : YP_001561515.1
Strain : Delftia acidovorans SPH-1
Genome accession: NC_010002
Putative virulence/resistance : Resistance
Product : mercuric transport protein periplasmic protein
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2608
EC number : -
Position : 518288 - 518566 bp
Length : 279 bp
Strand : -
Note : TIGRFAM: mercuric transport protein periplasmic component; PFAM: Heavy metal transport/detoxification protein; KEGG: ajs:Ajs_1299 mercuric transport protein periplasmic component

DNA sequence :
GTGAAGAAACTTGCCACCGCTATTGCCCTGGCCGTTACCCTGGGCGCTCCGGCGTGGGCCGCCACCAAGACCGTCACACT
GTCGGTGCCCGATATGACCTGCGCGTCGTGTCCGATCACGGTCAAGATGGCCCTGTTCAAGGTGGCCGGGGTCCAGAAGA
CCGAGGTCAGCTATGAAAAGCGGGAAGCCGTCGTGACCTTCGACGATGCCAAGACCAACGCCGGGGCCTTGGCCAAGGCC
ACCGCAAACGCGGGCTACCCCGCCACCGTCAAGCAGTGA

Protein sequence :
MKKLATAIALAVTLGAPAWAATKTVTLSVPDMTCASCPITVKMALFKVAGVQKTEVSYEKREAVVTFDDAKTNAGALAKA
TANAGYPATVKQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merP AAN62179.1 periplasmic mercuric ion binding protein MerP Not tested PAGI-2(C) Protein 9e-17 84
unnamed ABR13399.1 copper-transporting ATPase 2 Not tested PAGI-5 Protein 2e-17 73
merP ACN81007.1 MerP periplasmic mercuric ion binding protein Not tested AbaR5 Protein 2e-14 72
merP CAJ77062.1 Periplasmic mercuric ion binding protein Not tested AbaR1 Protein 1e-14 72
merP AGK07023.1 MerP Not tested SGI1 Protein 6e-15 70
merP AGK07081.1 MerP Not tested SGI1 Protein 6e-15 70
merP YP_006098389.1 mercuric ion transport protein Not tested Tn2411 Protein 9e-15 70
merP ABQ57373.1 MerP Not tested SGI1 Protein 6e-15 70
merP AET25399.1 MerP Not tested PAGI-2(C) Protein 6e-15 70
merP AFG30122.1 MerP Not tested PAGI-2 Protein 6e-15 70

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Daci_0484 YP_001561515.1 mercuric transport protein periplasmic protein BAC0678 Protein 3e-14 68
Daci_0484 YP_001561515.1 mercuric transport protein periplasmic protein BAC0679 Protein 7e-14 68
Daci_0484 YP_001561515.1 mercuric transport protein periplasmic protein BAC0231 Protein 1e-13 67
Daci_0484 YP_001561515.1 mercuric transport protein periplasmic protein BAC0675 Protein 4e-12 65
Daci_0484 YP_001561515.1 mercuric transport protein periplasmic protein BAC0674 Protein 5e-14 56