Gene Information

Name : set (USA300HOU_0435)
Accession : YP_001574341.1
Strain : Staphylococcus aureus TCH1516
Genome accession: NC_010079
Putative virulence/resistance : Virulence
Product : superantigen-like protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 460534 - 461211 bp
Length : 678 bp
Strand : +
Note : these proteins share structural homology to known superantigen proteins but do not exhibit any of the properties expected such as histocompatibility complex class II binding or broad T-cell activation

DNA sequence :
ATGAAATTAAAAAATATTGCTAAAGCAAGTTTAGCACTAGGGATTTTAACAACAGGGATGATTACAACTACTGCTCAGCC
AGTAAAAGCAAGTACATTAGAGGTTAGATCACAAGCTACTCAAGACTTGAGTGAATATTATAATAGACCGTTCTTTGAGT
ATACAAATCAGTCAGGATATAAAGAGGAAGGAAAAGTGACGTTTACTCCTAATTATCAACTTATAGATGTAACTTTAACT
GGGAATGAAAAGCAAAATTTTGGTGAAGATATTTCTAATGTAGATATATTTGTTGTAAGAGAAAATTCTGATAGATCTGG
TAATACAGCTTCAATTGGTGGTATTACTAAAACAAACGGTTCAAATTATATTGATAAAGTAAAAGATGTAAATTTAATAA
TTACTAAAAACATCGATAGTGTTACATCAACGTCAACATCATCTACATATACAATTAATAAAGAAGAAATTTCATTAAAA
GAACTTGATTTTAAATTAAGAAAGCATTTAATTGATAAACATAACCTTTATAAGACAGAACCTAAAGACAGTAAAATTCG
AATTACTATGAAAGATGGTGGGTTCTACACATTTGAATTGAATAAAAAGTTACAAACACACCGTATGGGTGATGTTATTG
ATGGCAGAAATATAGAAAAAATTGAAGTGAATTTATAA

Protein sequence :
MKLKNIAKASLALGILTTGMITTTAQPVKASTLEVRSQATQDLSEYYNRPFFEYTNQSGYKEEGKVTFTPNYQLIDVTLT
GNEKQNFGEDISNVDIFVVRENSDRSGNTASIGGITKTNGSNYIDKVKDVNLIITKNIDSVTSTSTSSTYTINKEEISLK
ELDFKLRKHLIDKHNLYKTEPKDSKIRITMKDGGFYTFELNKKLQTHRMGDVIDGRNIEKIEVNL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
SACOL0478 YP_185368.1 superantigen-like protein Virulence vSa¥á Protein 7e-86 100
set11nm YP_001331434.1 superantigen-like protein Virulence vSa¥á Protein 7e-86 100
SAUSA300_0407 YP_493121.1 superantigen-like protein Virulence vSa¥á Protein 7e-86 100
set15 NP_370957.1 superantigen-like protein Virulence vSa¥á Protein 8e-62 75
set15 NP_373644.1 superantigen-like protein Virulence vSa¥á Protein 8e-62 75
SAMSHR1132_03810 YP_005324902.1 exotoxin Virulence vSa¥á Protein 2e-56 74
SAKOR_00417 YP_008490601.1 Exotoxin Not tested vSa¥á Protein 4e-58 66
SAR0435 YP_039886.1 superantigen-like protein Virulence vSa¥á Protein 5e-53 65
SAS0396 YP_042522.1 superantigen-like protein Virulence vSa¥á Protein 2e-52 64
set26 NP_645211.1 superantigen-like protein Virulence vSa¥á Protein 2e-52 64
set3 YP_039879.1 superantigen-like protein 5 Virulence vSa¥á Protein 1e-32 50
set5nm YP_001331426.1 superantigen-like protein 5 Virulence vSa¥á Protein 2e-31 48
SAUSA300_0399 YP_493113.1 superantigen-like protein 5 Virulence vSa¥á Protein 2e-31 48
set10 NP_370949.1 superantigen-like protein 5 Virulence vSa¥á Protein 7e-32 48
set10 NP_373636.1 superantigen-like protein 5 Virulence vSa¥á Protein 7e-32 48
SAKOR_00409 YP_008490593.1 Exotoxin Virulence vSa¥á Protein 4e-32 48
SAS0384 YP_042509.1 superantigen-like protein Virulence vSa¥á Protein 1e-33 47
set16 NP_645199.1 superantigen-like protein Virulence vSa¥á Protein 1e-33 47
SAS0388 YP_042513.1 superantigen-like protein 5 Virulence vSa¥á Protein 9e-32 47
set20 NP_645203.1 superantigen-like protein 5 Virulence vSa¥á Protein 9e-32 47
SAMSHR1132_03750 YP_005324897.1 exotoxin 3 Virulence vSa¥á Protein 1e-28 46
set6 NP_373632.1 superantigen-like protein Virulence vSa¥á Protein 6e-32 46
SAR0422 YP_039874.1 superantigen-like protein Virulence vSa¥á Protein 2e-32 46
set6 NP_370946.1 superantigen-like protein Virulence vSa¥á Protein 6e-32 46
SAKOR_00404 YP_008490588.1 Exotoxin Virulence vSa¥á Protein 1e-31 45
SACOL0468 YP_185358.1 superantigen-like protein Virulence vSa¥á Protein 2e-30 44
set1nm YP_001331422.1 superantigen-like protein Virulence vSa¥á Protein 2e-30 44
SAUSA300_0395 YP_493109.1 superantigen-like protein Virulence vSa¥á Protein 2e-30 44
SAMSHR1132_03720 YP_005324894.1 exotoxin Virulence vSa¥á Protein 1e-29 43
set6nm YP_001331427.1 superantigen-like protein Virulence vSa¥á Protein 3e-27 43
SAUSA300_0400 YP_493114.1 superantigen-like protein Virulence vSa¥á Protein 3e-27 43
set21 NP_645204.1 superantigen-like protein Virulence vSa¥á Protein 8e-28 43
SAS0389 YP_042514.1 superantigen-like protein Virulence vSa¥á Protein 8e-28 43
set9 NP_373635.1 superantigen-like protein Virulence vSa¥á Protein 1e-28 43
set4 YP_039882.1 superantigen-like protein Virulence vSa¥á Protein 3e-24 42
SAMSHR1132_03730 YP_005324895.1 exotoxin Virulence vSa¥á Protein 3e-24 41
set7 YP_493110.1 superantigen-like protein Virulence vSa¥á Protein 4e-22 41
SAKOR_00410 YP_008490594.1 Exotoxin Virulence vSa¥á Protein 5e-28 41
set7nm YP_001331428.1 superantigen-like protein 7 Virulence vSa¥á Protein 3e-27 41
set7 NP_370947.1 superantigen-like protein Virulence vSa¥á Protein 1e-21 41
SAUSA300_0401 YP_493115.1 superantigen-like protein 7 Virulence vSa¥á Protein 3e-27 41
set7 NP_373633.1 superantigen-like protein Virulence vSa¥á Protein 4e-22 41
SACOL0469 YP_185359.1 superantigen-like protein Virulence vSa¥á Protein 4e-22 41
set2nm YP_001331423.1 superantigen-like protein Virulence vSa¥á Protein 4e-22 41
SAKOR_00405 YP_008490589.1 Exotoxin Virulence vSa¥á Protein 5e-22 41