Gene Information

Name : Bmul_5358 (Bmul_5358)
Accession : YP_001585320.1
Strain :
Genome accession: NC_010087
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 45469 - 46287 bp
Length : 819 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: bam:Bamb_5785 two component transcriptional regulator, winged helix family

DNA sequence :
ATGGCGGCAGCGGCCGCGCGCCGCCATTCGAGCCGGGCGCCGTCCGATCCGGCATCCGCCCCGCAACCCGACCGCGCTCC
GGCGCGCCGCGCCATCGCCATGGACCATCCGAAACGCATCCTGATCGTCGAGGACGACGCCGACATCGCCGACGTGCTGA
GCCTGCATCTGCGCGACGAACGCTACGAGGTCGTGCATAGCGCGGACGGCGCGCAAGGGCTGCGGCTGCTGGAACAGGGC
GGCTGGGACGCGCTGATCCTCGATCTGATGCTGCCCGGCGTCGACGGCCTCGAAATCTGCCGGCGCGCGCGCGCGATGGC
GCGCTACACGCCGATCATCATCACGAGCGCGCGTTCGAGCGAGGTGCACCGGATCCTCGGCCTCGAAATCGGCGCGGACG
ACTATCTCGCGAAGCCGTTTTCGGTGCTCGAACTGGTGGCGCGCGTGAAGGCGCTGCTGCGGCGCGTCGACGCGCTCGCG
CGCGATTCGCGGATCGATGCGGGCACGCTCGACGTCGCGGGACTGTCGATCGACCCCATCGCGCGCGAGGCCAGCGTCGA
CGGCACGCGCATCGACCTGACGCCGCGCGAGTTCGATCTGCTGTACTTCTTCGCGCGCCATCCGGGCAAGGTGTTCTCGC
GCATGGATCTGCTCAATGCGGTATGGGGCTATCAGCACGAAGGCTACGAGCACACGGTGAACACGCACATCAACCGGCTG
CGCGCGAAGATCGAGGCCGATCCGGCCGAGCCCGTGCGGATCCTGACCGTGTGGGGGCGCGGCTACAAGCTCGCGGCCCC
CGAGCAGCGGGACGCATGA

Protein sequence :
MAAAAARRHSSRAPSDPASAPQPDRAPARRAIAMDHPKRILIVEDDADIADVLSLHLRDERYEVVHSADGAQGLRLLEQG
GWDALILDLMLPGVDGLEICRRARAMARYTPIIITSARSSEVHRILGLEIGADDYLAKPFSVLELVARVKALLRRVDALA
RDSRIDAGTLDVAGLSIDPIAREASVDGTRIDLTPREFDLLYFFARHPGKVFSRMDLLNAVWGYQHEGYEHTVNTHINRL
RAKIEADPAEPVRILTVWGRGYKLAAPEQRDA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 7e-72 61
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-71 61

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bmul_5358 YP_001585320.1 two component transcriptional regulator AE000516.2.gene3505. Protein 2e-38 45
Bmul_5358 YP_001585320.1 two component transcriptional regulator NC_012469.1.7685629. Protein 7e-42 45
Bmul_5358 YP_001585320.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 1e-35 43
Bmul_5358 YP_001585320.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 1e-35 43
Bmul_5358 YP_001585320.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 1e-35 43
Bmul_5358 YP_001585320.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 1e-35 43
Bmul_5358 YP_001585320.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 1e-35 43
Bmul_5358 YP_001585320.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 1e-35 43
Bmul_5358 YP_001585320.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 1e-35 43
Bmul_5358 YP_001585320.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 1e-35 43
Bmul_5358 YP_001585320.1 two component transcriptional regulator HE999704.1.gene1528. Protein 8e-34 43
Bmul_5358 YP_001585320.1 two component transcriptional regulator AF155139.2.orf0.gene Protein 2e-42 43
Bmul_5358 YP_001585320.1 two component transcriptional regulator AE015929.1.gene1106. Protein 1e-30 42
Bmul_5358 YP_001585320.1 two component transcriptional regulator HE999704.1.gene2815. Protein 1e-40 42
Bmul_5358 YP_001585320.1 two component transcriptional regulator BAC0039 Protein 4e-32 42
Bmul_5358 YP_001585320.1 two component transcriptional regulator BAC0596 Protein 4e-31 42
Bmul_5358 YP_001585320.1 two component transcriptional regulator CP000034.1.gene2186. Protein 4e-32 42
Bmul_5358 YP_001585320.1 two component transcriptional regulator NC_002695.1.916589.p Protein 4e-32 42
Bmul_5358 YP_001585320.1 two component transcriptional regulator CP001138.1.gene2239. Protein 4e-31 42
Bmul_5358 YP_001585320.1 two component transcriptional regulator CP001918.1.gene3444. Protein 2e-31 42
Bmul_5358 YP_001585320.1 two component transcriptional regulator FJ349556.1.orf0.gene Protein 1e-38 41
Bmul_5358 YP_001585320.1 two component transcriptional regulator AE016830.1.gene1681. Protein 1e-42 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bmul_5358 YP_001585320.1 two component transcriptional regulator VFG1563 Protein 4e-72 61
Bmul_5358 YP_001585320.1 two component transcriptional regulator VFG1702 Protein 4e-72 61
Bmul_5358 YP_001585320.1 two component transcriptional regulator VFG1389 Protein 3e-31 45