Gene Information

Name : SPAB_03337 (SPAB_03337)
Accession : YP_001589528.1
Strain : Salmonella enterica SGSC4150; SPB7
Genome accession: NC_010102
Putative virulence/resistance : Virulence
Product : hypothetical protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2003
EC number : -
Position : 2795883 - 2796362 bp
Length : 480 bp
Strand : +
Note : COG: COG2003 DNA repair proteins; Psort location: extracellular, including cell wall, score: 9

DNA sequence :
ATGAGACAACAGTTACCGCTGTTTGCCGCCACATTACCGGCATCCGCACAACAAATCATCCGGGAAGCCTTAACCCTGCT
GGAGAGCCAGTTACGCGAACCCGGGGCGGCATTTACCTCCAGCCATGCTGTCCGGGACTGGCTACGCCTGCAACTCTCCG
CGCCAGAGCGGGAAGAATTTGTTGCGCTCTTCCTCGATAACCAGCATCGCCTTATTGCTCACGAAACGCTCTTCAGCGGC
ACTATCAACCATACTCAGGTCCATCCCCGCGAAGTGGTGAAATCCGGTCTGAAACATAACGCCGCCGCTGTCATTGTGGC
GCATTGTCATCCGTCGGGGCTTGCCGATCCCAGCCTGGCGGACCGTCAGATAACAGAGCGGCTCAGACAGGCCCTGGACC
TAGTGGATATCCGTCTGCTGGATCACCTGGTGGTTGGCGGCATGGAGATTGTCTCGTTCGCTGAACGCGGCTGGCTTTAA

Protein sequence :
MRQQLPLFAATLPASAQQIIREALTLLESQLREPGAAFTSSHAVRDWLRLQLSAPEREEFVALFLDNQHRLIAHETLFSG
TINHTQVHPREVVKSGLKHNAAAVIVAHCHPSGLADPSLADRQITERLRQALDLVDIRLLDHLVVGGMEIVSFAERGWL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed AAK00479.1 unknown Not tested SHI-1 Protein 4e-37 61
yeeS NP_838484.1 RADC family DNA repair protein Not tested SHI-1 Protein 9e-39 59
yeeS NP_708770.1 RADC family DNA repair protein Not tested SHI-1 Protein 9e-39 59
yeeS CAI43901.1 YeeS protein Not tested LEE Protein 3e-39 59
Z1217 NP_286752.1 RadC family DNA repair protein Not tested TAI Protein 3e-38 58
unnamed CAD42098.1 hypothetical protein Not tested PAI II 536 Protein 9e-38 58
yeeS AAZ04458.1 putative RadC-like protein Not tested PAI I APEC-O1 Protein 1e-39 58
z1217 CAD33787.1 Z1217 protein Not tested PAI I 536 Protein 1e-38 58
yeeS YP_854323.1 radC-like protein YeeS Not tested PAI I APEC-O1 Protein 2e-39 58
c5152 NP_757000.1 radC-like protein yeeS Not tested PAI II CFT073 Protein 2e-39 58
unnamed CAD66203.1 hypothetical protein Not tested PAI III 536 Protein 1e-38 58
yeeS CAE85201.1 YeeS protein Not tested PAI V 536 Protein 1e-38 58
yeeS CAI43846.1 YeeS protein Not tested LEE Protein 1e-38 58
yeeS ADD91702.1 YeeS Not tested PAI-I AL862 Protein 1e-38 58
unnamed AAL67345.1 intergenic-region protein Not tested PAI II CFT073 Protein 2e-38 58
aec73 AAW51756.1 Aec73 Not tested AGI-3 Protein 1e-38 58
unnamed AAL08475.1 unknown Not tested SRL Protein 1e-38 58
ECO103_3589 YP_003223446.1 radC-like protein YeeS Not tested LEE Protein 1e-38 57
Z1657 NP_287160.1 RadC family DNA repair protein Not tested TAI Protein 8e-37 57
VC0510 NP_230161.1 DNA repair protein RadC-like protein Not tested VSP-2 Protein 7e-27 56
VC1786 NP_231421.1 DNA repair protein RadC Not tested VPI-2 Protein 1e-29 53
VC0395_A1383 YP_001217326.1 DNA repair protein RadC Not tested VPI-2 Protein 1e-29 53
VPI2_0034 ACA01849.1 DNA repair protein RadC Not tested VPI-2 Protein 8e-30 53
radC AAN62140.1 putative DNA repair protein RadC Not tested PAGI-2(C) Protein 5e-27 52
radC AAN62275.1 putative DNA repair protein RadC Not tested PAGI-3(SG) Protein 9e-27 46

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SPAB_03337 YP_001589528.1 hypothetical protein VFG0660 Protein 2e-39 59
SPAB_03337 YP_001589528.1 hypothetical protein VFG1617 Protein 4e-38 58
SPAB_03337 YP_001589528.1 hypothetical protein VFG1678 Protein 4e-39 58
SPAB_03337 YP_001589528.1 hypothetical protein VFG1528 Protein 6e-39 58
SPAB_03337 YP_001589528.1 hypothetical protein VFG1066 Protein 4e-39 58
SPAB_03337 YP_001589528.1 hypothetical protein VFG1119 Protein 4e-30 53