Gene Information

Name : qacF (BCAN_A0939)
Accession : YP_001592771.1
Strain :
Genome accession: NC_010103
Putative virulence/resistance : Resistance
Product : quaternary ammonium compound-resistance protein qacF
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2076
EC number : -
Position : 899665 - 899997 bp
Length : 333 bp
Strand : -
Note : -

DNA sequence :
ATGCCGGTTTATACTTTTCTCGCCATTGCAATCTTTTCCGAAGTCATCGGCACACTAAGCCTCAAGGCATCGGAAGGGTT
TTCGCGCCTTGGCCCATCCATCGTGGTGGTGGTCGCCTATGGCCTCGCCTTCTATTTCCTGTCACTAACGCTGAAAACAA
TCCCGGTCGGTGTCGCCTATGCGATCTGGTCCGGCGTTGGCGTAACGCTGGTGGCGCTCATCGGCTGGCTGGTATTCGGG
CAGAAGCTGGATCTTCCCGCAATTGTCGGCATGGGCCTCATCATCGCGGGCGTGATCGTCTTGAATTTGCTTTCCAACAC
CGCTCAGCATTAG

Protein sequence :
MPVYTFLAIAIFSEVIGTLSLKASEGFSRLGPSIVVVVAYGLAFYFLSLTLKTIPVGVAYAIWSGVGVTLVALIGWLVFG
QKLDLPAIVGMGLIIAGVIVLNLLSNTAQH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
qacEdelta1 AGK07109.1 QacEdelta1 Not tested SGI1 Protein 9e-25 63
qacEdelta1 AGF35028.1 QacEdelta1 Not tested SGI1 Protein 9e-25 63
qacEdelta1 CAJ77052.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 9e-25 63
qacEdelta1 AFV53123.1 QacEdelta1 multidrug exporter Not tested AbGRI2-1 Protein 9e-25 63
qacEdelta1 AGF35063.1 QacEdelta1 Not tested SGI1 Protein 9e-25 63
qacEdelta1 CAJ77088.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 9e-25 63
qacEdelta1 AGK36647.1 QacEdelta1 Not tested AbaR26 Protein 9e-25 63
qacEdelta1 AGK06933.1 QacEdelta1 Not tested SGI1 Protein 9e-25 63
qacE-deltal ACF06159.1 quartenary ammonium compound resistance protein Not tested Tn5036-like Protein 9e-25 63
qacEdelta1 AAK02047.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 9e-25 63
qacEdelta1 AGK06970.1 QacEdelta1 Not tested SGI1 Protein 9e-25 63
qacE-delta1 ACY75523.1 QacE-delta1 Not tested Tn6060 Protein 9e-25 63
qacEdelta1 AAK02056.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 9e-25 63
ACICU_00227 YP_001844886.1 membrane transporter Not tested AbaR20 Protein 1e-24 63
qacEdelta1 AGK06979.1 QacEdelta1 Not tested SGI1 Protein 9e-25 63
qacE-delta1 ACY75532.1 QacE-delta1 Not tested Tn6060 Protein 9e-25 63
qacEdelta1 ABB48428.1 QacEdelta1 Not tested SGI1 Protein 9e-25 63
qacEdelta1 YP_005797134.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 1e-24 63
qacEdelta1 AGK07016.1 QacEdelta1 Not tested SGI1 Protein 9e-25 63
qacE-delta1 AET25389.1 QacE-delta1 Not tested PAGI-2(C) Protein 9e-25 63
qacEdelta1 ABZ01839.1 QacEdelta1 Not tested SGI2 Protein 9e-25 63
qacEdelta1 YP_005797150.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 1e-24 63
qacEdelta1 AGK07074.1 QacEdelta1 Not tested SGI1 Protein 9e-25 63
qacE-delta1 AFG30112.1 QacE-delta1 Not tested PAGI-2 Protein 9e-25 63
qacEdelta1 CAJ77030.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 9e-25 63
ebr YP_006098377.1 putative ethidium bromide resistance protein Not tested Tn2411 Protein 1e-24 63
qacEdelta1 AGK07100.1 QacEdelta1 Not tested SGI1 Protein 9e-25 63
qacEdelta1 AGF34989.1 QacEdelta1 Not tested SGI1 Protein 9e-25 63
qacEdelta1 CAJ77049.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 9e-25 63
qacEdelta1 ACN81026.1 QacEdelta1 Not tested AbaR5 Protein 1e-24 63
unnamed CAD42067.1 hypothetical protein Not tested PAI II 536 Protein 4e-15 46
unnamed CAD42068.1 hypothetical protein Not tested PAI II 536 Protein 3e-11 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
qacF YP_001592771.1 quaternary ammonium compound-resistance protein qacF CP004022.1.gene1549. Protein 6e-24 64
qacF YP_001592771.1 quaternary ammonium compound-resistance protein qacF BAC0324 Protein 1e-30 63
qacF YP_001592771.1 quaternary ammonium compound-resistance protein qacF BAC0323 Protein 4e-25 63
qacF YP_001592771.1 quaternary ammonium compound-resistance protein qacF BAC0322 Protein 1e-29 62
qacF YP_001592771.1 quaternary ammonium compound-resistance protein qacF CP001138.1.gene1489. Protein 3e-26 60
qacF YP_001592771.1 quaternary ammonium compound-resistance protein qacF BAC0377 Protein 2e-24 58
qacF YP_001592771.1 quaternary ammonium compound-resistance protein qacF NC_010410.6003348.p0 Protein 9e-26 56
qacF YP_001592771.1 quaternary ammonium compound-resistance protein qacF BAC0002 Protein 9e-26 56
qacF YP_001592771.1 quaternary ammonium compound-resistance protein qacF NC_002695.1.913273.p Protein 2e-24 55
qacF YP_001592771.1 quaternary ammonium compound-resistance protein qacF BAC0150 Protein 2e-24 55
qacF YP_001592771.1 quaternary ammonium compound-resistance protein qacF BAC0139 Protein 6e-19 53
qacF YP_001592771.1 quaternary ammonium compound-resistance protein qacF BAC0192 Protein 5e-19 51
qacF YP_001592771.1 quaternary ammonium compound-resistance protein qacF BAC0140 Protein 1e-15 48
qacF YP_001592771.1 quaternary ammonium compound-resistance protein qacF BAC0329 Protein 4e-14 47
qacF YP_001592771.1 quaternary ammonium compound-resistance protein qacF BAC0321 Protein 3e-19 43
qacF YP_001592771.1 quaternary ammonium compound-resistance protein qacF BAC0325 Protein 7e-14 43
qacF YP_001592771.1 quaternary ammonium compound-resistance protein qacF BAC0327 Protein 7e-14 42
qacF YP_001592771.1 quaternary ammonium compound-resistance protein qacF BAC0326 Protein 2e-13 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
qacF YP_001592771.1 quaternary ammonium compound-resistance protein qacF VFG1586 Protein 2e-15 46
qacF YP_001592771.1 quaternary ammonium compound-resistance protein qacF VFG1587 Protein 1e-11 42