
|
Name : fliQ (BCAN_B1162) Accession : YP_001595062.1 Strain : Genome accession: NC_010104 Putative virulence/resistance : Virulence Product : flagellar biosynthesis protein FliQ Function : - COG functional category : N : Cell motility COG ID : COG1987 EC number : - Position : 1121851 - 1122117 bp Length : 267 bp Strand : - Note : 'FliQ, with proteins FliP and FliR, forms the core of the central channel in the flagella export apparatus; Bradyrhizobium have one thick flagellum and several thin flagella; the protein in this cluster is associated with the thick flagellum' DNA sequence : GTGAACGAGGCTGATGCGCTTGATATCGTCAATTCGGCGATCTGGACTGTGCTGACGGCAAGCGGGCCGGCGGTGCTTGC CGCCATGCTTGCGGGCATTGGGATTGCGCTGTTTCAGGCGCTGACGCAAATTCAGGAAATGACCCTGACCTTCGTGCCGA AAATCATCGTCATTTTCGTCGTCCTGGCGCTGACGGCACCTTTTGTCGGTGCGCAGATCAATGCTTTCACGCTGCTTGCC TATTCCCGCATCGAAAAGGGTTTTTAA Protein sequence : MNEADALDIVNSAIWTVLTASGPAVLAAMLAGIGIALFQALTQIQEMTLTFVPKIIVIFVVLALTAPFVGAQINAFTLLA YSRIEKGF |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| escS | CAI43888.1 | EscS protein | Virulence | LEE | Protein | 6e-04 | 42 |
| escS | AAK26701.1 | EscS | Virulence | LEE | Protein | 5e-04 | 42 |
| escS | AAL57528.1 | EscS | Virulence | LEE | Protein | 5e-04 | 42 |
| escS | CAC81848.1 | EscS protein | Virulence | LEE II | Protein | 5e-04 | 42 |
| unnamed | AAL06355.1 | EscS | Virulence | LEE | Protein | 3e-04 | 42 |
| escS | YP_003223489.1 | T3SS structure protein EscS | Virulence | LEE | Protein | 8e-04 | 42 |
| escS | YP_003232139.1 | T3SS structure protein EscS | Virulence | LEE | Protein | 8e-04 | 42 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| fliQ | YP_001595062.1 | flagellar biosynthesis protein FliQ | VFG0187 | Protein | 0.36 | 46 |