Gene Information

Name : YpAngola_A1363 (YpAngola_A1363)
Accession : YP_001605891.1
Strain : Yersinia pestis Angola
Genome accession: NC_010159
Putative virulence/resistance : Virulence
Product : AlpA family transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG3311
EC number : -
Position : 1422471 - 1422671 bp
Length : 201 bp
Strand : -
Note : identified by match to protein family HMM PF05930

DNA sequence :
ATGTCTGATATTAATTTGATCCGCTTACCTGAAGTGATTGAGAAAATACGACTGAAAAAATCATCAATTTATCATTTGAT
TAGCCTCAATCAATTCCCTCGCCCAATAAAATTAGGGCCGCGTTCAGTGGCCTGGGTTGAAAGTGAAGTCGATGAATGGG
TCATTATCAGAATCAATCAACGCGAGGAGGGTCGCAACTAA

Protein sequence :
MSDINLIRLPEVIEKIRLKKSSIYHLISLNQFPRPIKLGPRSVAWVESEVDEWVIIRINQREEGRN

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
VC1809 NP_231443.1 transcriptional regulator Not tested VPI-2 Protein 4e-11 50
VC0395_A1406 YP_001217349.1 transcriptional regulator Not tested VPI-2 Protein 4e-11 50
VPI2_0041 ACA01856.1 predicted transcriptional regulator Not tested VPI-2 Protein 3e-11 50
PMI2608 YP_002152324.1 prophage regulatory protein Not tested Not named Protein 1e-09 49
unnamed CAA21398.1 - Not tested HPI Protein 1e-10 48
unnamed CAB46594.1 DNA-binding protein Not tested HPI Protein 7e-11 48
VC1785 NP_231420.1 transcriptional regulator Not tested VPI-2 Protein 5e-10 45
VC0395_A1382 YP_001217325.1 transcriptional regulator Not tested VPI-2 Protein 5e-10 45
VPI2_0033 AAX20900.1 transcriptional regulator Not tested VPI-2 Protein 4e-10 45
Z1188 NP_286723.1 hypothetical protein Not tested TAI Protein 2e-04 41
Z1627 NP_287131.1 hypothetical protein Not tested TAI Protein 2e-04 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
YpAngola_A1363 YP_001605891.1 AlpA family transcriptional regulator VFG1141 Protein 1e-11 50
YpAngola_A1363 YP_001605891.1 AlpA family transcriptional regulator VFG1118 Protein 2e-10 45