Gene Information

Name : trwL4 (Btr_2514)
Accession : YP_001610471.1
Strain : Bartonella tribocorum CIP 105476
Genome accession: NC_010161
Putative virulence/resistance : Virulence
Product : TrwL4 protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2443848 - 2444168 bp
Length : 321 bp
Strand : +
Note : Component of type IV secretion system; hypothetical protein

DNA sequence :
ATGAAAAAATCAAATACCCTTCAAACAATAGTTCATAATAAAACTATTCCAATATCTGCAGCTTTAACTGTATTCTTTAT
GAATAATTCTGCATATGCTAGTAACCCGACAACTCTGACAAATGCAAAGACAGCTTTAGACGGCTTGAAAAGTGACTTAG
AAAAACTTATCCCTATTGCCGCTGGTGTTATACTTTTATGTCTAGCAATTGCTTATGCGGGGCGATACATCGAAAAATCT
ACATTCATACGATGGGCAGTCGGGGTTGTTATCGCTGGTTCAGCATCCCAACTTGCTACACTGTTATTTACTAGATCTTA
A

Protein sequence :
MKKSNTLQTIVHNKTIPISAALTVFFMNNSAYASNPTTLTNAKTALDGLKSDLEKLIPIAAGVILLCLAIAYAGRYIEKS
TFIRWAVGVVIAGSASQLATLLFTRS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
trwL4 YP_001610471.1 TrwL4 protein Virulence Not named Protein 6e-43 100
trwL4 CAD42839.1 TrwL4 protein Not tested trw-PAI Protein 4e-43 100
trwL6 YP_001610473.1 TrwL6 protein Virulence Not named Protein 2e-39 92
trwL6 CAD42841.1 TrwL6 protein Not tested trw-PAI Protein 1e-39 92
trwL1 CAD42836.1 TrwL1 protein Not tested trw-PAI Protein 2e-37 89
trwL1 YP_001610468.1 TrwL1 protein Virulence Not named Protein 3e-37 89
trwL2 CAD42837.1 TrwL2 protein Not tested trw-PAI Protein 5e-38 88
trwL2 YP_001610469.1 TrwL2 protein Virulence Not named Protein 7e-38 88
trwL5 CAD42840.1 TrwL5 protein Not tested trw-PAI Protein 2e-34 84
trwL5 YP_001610472.1 TrwL5 protein Virulence Not named Protein 2e-34 84
trwL3 CAD42838.1 TrwL3 protein Not tested trw-PAI Protein 7e-33 78
trwL3 YP_001610470.1 TrwL3 protein Virulence Not named Protein 1e-32 78

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
trwL4 YP_001610471.1 TrwL4 protein VFG2251 Protein 9e-27 61
trwL4 YP_001610471.1 TrwL4 protein VFG2256 Protein 2e-27 61
trwL4 YP_001610471.1 TrwL4 protein VFG2254 Protein 1e-25 60
trwL4 YP_001610471.1 TrwL4 protein VFG2255 Protein 7e-25 60
trwL4 YP_001610471.1 TrwL4 protein VFG2250 Protein 1e-22 59
trwL4 YP_001610471.1 TrwL4 protein VFG2253 Protein 2e-26 56
trwL4 YP_001610471.1 TrwL4 protein VFG2252 Protein 3e-22 56