Gene Information

Name : sce2434 (sce2434)
Accession : YP_001613073.1
Strain : Sorangium cellulosum So ce 56
Genome accession: NC_010162
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3276373 - 3277098 bp
Length : 726 bp
Strand : -
Note : Family membership

DNA sequence :
ATGCTAGAGGACCTCCTCAGCATGACCCGAACCCCTCAGACACCGGCGCGGACCGTCCTGCTCGTGGAGGACGACCCCAG
CATCGCGATGGGTCTCGAGATGAACCTGACCGCCGAGGGCTACCGCGTCCTCGTGGCCGAGGACGGCGAGCGCGGGCTCG
CGCTCGCCCGCGCCGGCGGGATCGATCTCATCATCATCGACGTCATGCTCCCCCGGCTGAACGGCTTCGAGCTGCTCCGC
ATCCTCCGGAACGAGCGGCGCACCCTGCCGGTGATCATGCTGTCCGCGCGCGGCGCCGAGATGGACAAGGTGATGGGCCT
CGAGCTCGGCGCCGAGGACTACATCACGAAGCCGTTCAGCCTGGCCGAGCTGCTCGCGCGCGTGAAGGCCGTGCTCCGGC
GCGACGCGATCGCGCGCGCCGACGGGGCGCAGCTGCGCGCCGGCGACATCGTGATCAACGCGGCGACGCGCGAGGTCCGC
CGCGGCGATGCGCTGATCGAGCTCACGGCGACCGAGTTCGACGTGCTGCTCTGCCTCGCCGAGGCGGGCGGCAGGGTCCT
GTCGAGGGAGCAGATCCAGGCCAAGGTCTGGGGCCCGACGCACCACGGGACCCCGCGCACCATCGACAATTTCATCCTCC
AGCTCCGCAACAAGCTGGAAGAGAACGCGACGACGCCGCGCCACCTGCTGACGGTGCGCGGTGTCGGCTACCGCTTCGTC
CCCTAG

Protein sequence :
MLEDLLSMTRTPQTPARTVLLVEDDPSIAMGLEMNLTAEGYRVLVAEDGERGLALARAGGIDLIIIDVMLPRLNGFELLR
ILRNERRTLPVIMLSARGAEMDKVMGLELGAEDYITKPFSLAELLARVKAVLRRDAIARADGAQLRAGDIVINAATREVR
RGDALIELTATEFDVLLCLAEAGGRVLSREQIQAKVWGPTHHGTPRTIDNFILQLRNKLEENATTPRHLLTVRGVGYRFV
P

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-33 43
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-32 42
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 6e-24 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
sce2434 YP_001613073.1 two-component response regulator NC_007622.3794948.p0 Protein 1e-27 43
sce2434 YP_001613073.1 two-component response regulator NC_003923.1003417.p0 Protein 1e-27 43
sce2434 YP_001613073.1 two-component response regulator NC_013450.8614146.p0 Protein 1e-27 43
sce2434 YP_001613073.1 two-component response regulator NC_002951.3238224.p0 Protein 1e-27 43
sce2434 YP_001613073.1 two-component response regulator NC_007793.3914065.p0 Protein 1e-27 43
sce2434 YP_001613073.1 two-component response regulator NC_002758.1121390.p0 Protein 1e-27 43
sce2434 YP_001613073.1 two-component response regulator NC_010079.5776364.p0 Protein 1e-27 43
sce2434 YP_001613073.1 two-component response regulator NC_002952.2859858.p0 Protein 1e-27 43
sce2434 YP_001613073.1 two-component response regulator NC_002952.2859905.p0 Protein 1e-36 43
sce2434 YP_001613073.1 two-component response regulator NC_002951.3237708.p0 Protein 1e-36 43
sce2434 YP_001613073.1 two-component response regulator NC_002758.1121668.p0 Protein 1e-36 43
sce2434 YP_001613073.1 two-component response regulator NC_009641.5332272.p0 Protein 1e-36 43
sce2434 YP_001613073.1 two-component response regulator NC_013450.8614421.p0 Protein 1e-36 43
sce2434 YP_001613073.1 two-component response regulator NC_007793.3914279.p0 Protein 1e-36 43
sce2434 YP_001613073.1 two-component response regulator NC_003923.1003749.p0 Protein 1e-36 43
sce2434 YP_001613073.1 two-component response regulator NC_007622.3794472.p0 Protein 1e-36 43
sce2434 YP_001613073.1 two-component response regulator NC_002745.1124361.p0 Protein 1e-36 43
sce2434 YP_001613073.1 two-component response regulator NC_009782.5559369.p0 Protein 1e-36 43
sce2434 YP_001613073.1 two-component response regulator AE015929.1.gene1106. Protein 4e-26 42
sce2434 YP_001613073.1 two-component response regulator CP000647.1.gene4257. Protein 4e-26 42
sce2434 YP_001613073.1 two-component response regulator BAC0533 Protein 4e-26 42
sce2434 YP_001613073.1 two-component response regulator AE016830.1.gene1681. Protein 2e-33 41
sce2434 YP_001613073.1 two-component response regulator CP001138.1.gene4273. Protein 8e-26 41
sce2434 YP_001613073.1 two-component response regulator BAC0197 Protein 2e-26 41
sce2434 YP_001613073.1 two-component response regulator CP001918.1.gene5135. Protein 6e-24 41
sce2434 YP_001613073.1 two-component response regulator CP001485.1.gene721.p Protein 6e-26 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
sce2434 YP_001613073.1 two-component response regulator VFG1702 Protein 4e-34 43
sce2434 YP_001613073.1 two-component response regulator VFG1389 Protein 5e-25 43
sce2434 YP_001613073.1 two-component response regulator VFG1563 Protein 7e-33 42
sce2434 YP_001613073.1 two-component response regulator VFG0596 Protein 2e-24 41