Gene Information

Name : sce3288 (sce3288)
Accession : YP_001613927.1
Strain : Sorangium cellulosum So ce 56
Genome accession: NC_010162
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 4605283 - 4606053 bp
Length : 771 bp
Strand : -
Note : Family membership

DNA sequence :
GTGCACCGGCCAGCGAGGCGACGCCTGCCGCCGGCGCGGATCGACGCGAACGGGAAGAGGACGACGACTGAGCCCCCGGC
TCGAGTACGGCGGAGACCCATGCGCATCCTGGTCATCGAAGACGAGCGCAAGATCGCGGGCTTCCTGCGCCGCGGCCTCG
CCGAGGAAGGGCACCAGGTGCACGTGGAGGAGGACCTCGCAGGCGCCCGGCGCGCGCTCGCCCAGGGCGACTATGACCTC
CTCCTCGTCGACCGCGCCTTGCCCGACGGTGACGGCCTGGACCTCATCCGCGAGCTCCGCCGCGGCGGCGCCGCCACCCC
GGCGATCTGCCTCACCGCGCGCGACCGGGTCGGCGAGCGCGTGGAGGGCCTCCACGGCGGCGCGGACGACTACCTCCCCA
AGCCGTTCTCGTTCGAGGAGCTGCTGGCGCGCATCGCCGCCGTATCGCGCCGCGCCGGGCGCAGCGAGCGCGTCGAGGTG
GCCGACCTGCTGATCGATCTCGCGGCCCACCGGGTCGAGCGCGCCGGGCGGGAGATCCACCTCACGGCGAAGGAGTTCGC
GCTGCTGCGCGCGCTCGCGGAGAGCGCCGGCCGGGTGCTCAGCCGCACCCGCCTGCTGGAGCGCGTCTGGGACGTGGGCC
ACGACCCTGGTACCAACGTCGTCGACGTGGCCATCAGCGCGCTGCGGGCCAAGGTGGATCGCGGCTTCGCGCGCCCGCTG
ATCCACACGGTGCGGGGCGTCGGGTATGTCCTCGAGGAGCGGCCGCGGTGA

Protein sequence :
MHRPARRRLPPARIDANGKRTTTEPPARVRRRPMRILVIEDERKIAGFLRRGLAEEGHQVHVEEDLAGARRALAQGDYDL
LLVDRALPDGDGLDLIRELRRGGAATPAICLTARDRVGERVEGLHGGADDYLPKPFSFEELLARIAAVSRRAGRSERVEV
ADLLIDLAAHRVERAGREIHLTAKEFALLRALAESAGRVLSRTRLLERVWDVGHDPGTNVVDVAISALRAKVDRGFARPL
IHTVRGVGYVLEERPR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-40 46
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 5e-40 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
sce3288 YP_001613927.1 two-component response regulator BAC0125 Protein 2e-41 48
sce3288 YP_001613927.1 two-component response regulator BAC0197 Protein 1e-42 47
sce3288 YP_001613927.1 two-component response regulator BAC0308 Protein 6e-42 46
sce3288 YP_001613927.1 two-component response regulator BAC0083 Protein 2e-41 46
sce3288 YP_001613927.1 two-component response regulator BAC0638 Protein 2e-38 46
sce3288 YP_001613927.1 two-component response regulator BAC0347 Protein 7e-40 45
sce3288 YP_001613927.1 two-component response regulator BAC0111 Protein 4e-45 45
sce3288 YP_001613927.1 two-component response regulator NC_013450.8614146.p0 Protein 8e-36 43
sce3288 YP_001613927.1 two-component response regulator NC_002951.3238224.p0 Protein 8e-36 43
sce3288 YP_001613927.1 two-component response regulator NC_007793.3914065.p0 Protein 8e-36 43
sce3288 YP_001613927.1 two-component response regulator NC_002758.1121390.p0 Protein 8e-36 43
sce3288 YP_001613927.1 two-component response regulator NC_010079.5776364.p0 Protein 8e-36 43
sce3288 YP_001613927.1 two-component response regulator NC_002952.2859858.p0 Protein 8e-36 43
sce3288 YP_001613927.1 two-component response regulator NC_007622.3794948.p0 Protein 8e-36 43
sce3288 YP_001613927.1 two-component response regulator NC_003923.1003417.p0 Protein 8e-36 43
sce3288 YP_001613927.1 two-component response regulator AE000516.2.gene3505. Protein 3e-25 42
sce3288 YP_001613927.1 two-component response regulator AE015929.1.gene1106. Protein 2e-32 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
sce3288 YP_001613927.1 two-component response regulator VFG0596 Protein 8e-41 46
sce3288 YP_001613927.1 two-component response regulator VFG1390 Protein 8e-38 45
sce3288 YP_001613927.1 two-component response regulator VFG1389 Protein 1e-30 43