Gene Information

Name : copR (Bpet4594)
Accession : YP_001633212.1
Strain : Bordetella petrii DSM 12804
Genome accession: NC_010170
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 4852615 - 4853289 bp
Length : 675 bp
Strand : -
Note : -

DNA sequence :
ATGCGAATTCTGGTCATCGAAGACGAGCGTAAGCTGGCACACTATCTGCAAAAGGGTTTGACGGAACATAACTACGTCGT
GGACATCGCAAGCAACGGAGTCGACGGCCGGCACGCCGCCCTGGAGGGCAATTACGATCTCGTCGTGCTCGATGTCATGC
TGCCAGGAATCGACGGATTTTGGATTCTGAAGGACTTGCGTGAAACCAAGGACACTCCCGTTCTCATGCTCACTGCGCGA
GACAAAGTGGAGGATAGGGTGCGGGGCCTTGAGAACGGAGCTGACGATTATTTGGTGAAGCCGTTTGCGTTTTCTGAGTT
ACTGGCGCGTATCCAGGCATTGCTTCGGCGAGGCCGCGGCCAGGAATCAACGCTGCTTAAACTGGGCGATCTCGAGTTGG
ACCTTGCTCGGCGAAAGGCGCATCGCGCGGGTATGCGACTGGACTTGACGGCGAAGGAGTTCACGCTGCTTGCGCTTTTA
TTGCGCCGGCAGGGGCAAGTTCTGTCCAGAACGATGTTGGCTGAACAAGTTTGGGATATGAACTTCGATAGCGACACGAA
TGCGATTGAAGTCGCTGTGCGACGCTTGCGAGCTAAGATCGACGACCCTTTTGACAGGAGGCTTTTGCATACGGTACGTG
GTATGGGTTATGTGTTAGAGGAACGCGGTGAATGA

Protein sequence :
MRILVIEDERKLAHYLQKGLTEHNYVVDIASNGVDGRHAALEGNYDLVVLDVMLPGIDGFWILKDLRETKDTPVLMLTAR
DKVEDRVRGLENGADDYLVKPFAFSELLARIQALLRRGRGQESTLLKLGDLELDLARRKAHRAGMRLDLTAKEFTLLALL
LRRQGQVLSRTMLAEQVWDMNFDSDTNAIEVAVRRLRAKIDDPFDRRLLHTVRGMGYVLEERGE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 5e-54 54
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-53 52

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
copR YP_001633212.1 two-component response regulator BAC0638 Protein 4e-52 63
copR YP_001633212.1 two-component response regulator BAC0083 Protein 8e-59 62
copR YP_001633212.1 two-component response regulator BAC0125 Protein 7e-61 61
copR YP_001633212.1 two-component response regulator BAC0197 Protein 2e-59 61
copR YP_001633212.1 two-component response regulator BAC0111 Protein 9e-60 58
copR YP_001633212.1 two-component response regulator BAC0308 Protein 7e-59 57
copR YP_001633212.1 two-component response regulator BAC0347 Protein 4e-51 56
copR YP_001633212.1 two-component response regulator CP001918.1.gene5135. Protein 1e-20 43
copR YP_001633212.1 two-component response regulator NC_002516.2.879194.p Protein 1e-29 42
copR YP_001633212.1 two-component response regulator HE999704.1.gene1528. Protein 1e-31 42
copR YP_001633212.1 two-component response regulator AE000516.2.gene3505. Protein 2e-27 42
copR YP_001633212.1 two-component response regulator NC_002952.2859858.p0 Protein 2e-37 41
copR YP_001633212.1 two-component response regulator NC_007622.3794948.p0 Protein 2e-37 41
copR YP_001633212.1 two-component response regulator NC_003923.1003417.p0 Protein 2e-37 41
copR YP_001633212.1 two-component response regulator NC_013450.8614146.p0 Protein 2e-37 41
copR YP_001633212.1 two-component response regulator NC_002951.3238224.p0 Protein 2e-37 41
copR YP_001633212.1 two-component response regulator NC_007793.3914065.p0 Protein 2e-37 41
copR YP_001633212.1 two-component response regulator NC_002758.1121390.p0 Protein 2e-37 41
copR YP_001633212.1 two-component response regulator NC_010079.5776364.p0 Protein 2e-37 41
copR YP_001633212.1 two-component response regulator CP000034.1.gene3834. Protein 6e-23 41
copR YP_001633212.1 two-component response regulator NC_002695.1.915041.p Protein 6e-23 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
copR YP_001633212.1 two-component response regulator VFG0596 Protein 2e-54 54
copR YP_001633212.1 two-component response regulator VFG1390 Protein 2e-39 45
copR YP_001633212.1 two-component response regulator VFG1389 Protein 6e-35 44
copR YP_001633212.1 two-component response regulator VFG0473 Protein 6e-32 42