Gene Information

Name : Bpet4609 (Bpet4609)
Accession : YP_001633227.1
Strain : Bordetella petrii DSM 12804
Genome accession: NC_010170
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 4869847 - 4870545 bp
Length : 699 bp
Strand : +
Note : -

DNA sequence :
GTGGGAAAATTGAAAATATTGGTCATTGAGGACGAGCGAAAGCTCGCGGAATATCTCAAGCGCGCGCTTTCCGAACATAA
CTACGTCGTCGATATTGCAATGGATGGTATTAGCGGACTTCATCTAGCCCAGGAGACGCAGTACGACTTGATTCTTCTAG
ACGTAATGTTGCCTGGACGAGATGGCTTTTCGGTATTGGCGGAATTGCGAAAAGGCGATCGGGTCCCTATCCTGATGCTT
ACCGCACGCGACAAGCTGGAGGATCGTGTTCGAGGGCTGCAAGATGGTGCTGACGACTACCTGGCAAAACCTTTCGCGCT
TTCAGAATTATTGGCACGCGTGCTTGCGCTGAGTCGACGCCAGAGTAACTCAGTTATCGAGCCGAACCGCCAAAATGTGC
TAAAGGTCGGCGATCTGGAGCTCGATCTGTTACGCCGCAGGGCGTCGCGTGGAGGCGTGCGCCTTGATCTCACGGCCAAG
GAGTTCACCTTGCTGGCACTGTTAATGAAGAAACAGGGCCAAGTCTTGTCACGCTTGGACCTGGCGGAGCAAGTGTGGGA
CATTAACTTCAACAGTAATACGAATGTAGTCGAAGTGGCAGTACGCCGACTGCGCGGCAAGGTTGATGACCCTTTTCCAA
CAAAACTCCTCCATACAGTACGCGGTATGGGATACGTACTTGAACCACGGGAAATTTGA

Protein sequence :
MGKLKILVIEDERKLAEYLKRALSEHNYVVDIAMDGISGLHLAQETQYDLILLDVMLPGRDGFSVLAELRKGDRVPILML
TARDKLEDRVRGLQDGADDYLAKPFALSELLARVLALSRRQSNSVIEPNRQNVLKVGDLELDLLRRRASRGGVRLDLTAK
EFTLLALLMKKQGQVLSRLDLAEQVWDINFNSNTNVVEVAVRRLRGKVDDPFPTKLLHTVRGMGYVLEPREI

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 8e-53 51
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-52 51

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bpet4609 YP_001633227.1 two-component response regulator BAC0083 Protein 6e-59 57
Bpet4609 YP_001633227.1 two-component response regulator BAC0125 Protein 1e-61 55
Bpet4609 YP_001633227.1 two-component response regulator BAC0197 Protein 8e-61 54
Bpet4609 YP_001633227.1 two-component response regulator BAC0638 Protein 8e-50 53
Bpet4609 YP_001633227.1 two-component response regulator BAC0111 Protein 1e-57 51
Bpet4609 YP_001633227.1 two-component response regulator BAC0308 Protein 2e-50 49
Bpet4609 YP_001633227.1 two-component response regulator BAC0347 Protein 5e-51 48
Bpet4609 YP_001633227.1 two-component response regulator NC_002516.2.879194.p Protein 3e-28 41
Bpet4609 YP_001633227.1 two-component response regulator NC_002952.2859905.p0 Protein 3e-32 41
Bpet4609 YP_001633227.1 two-component response regulator NC_009641.5332272.p0 Protein 5e-32 41
Bpet4609 YP_001633227.1 two-component response regulator NC_013450.8614421.p0 Protein 5e-32 41
Bpet4609 YP_001633227.1 two-component response regulator NC_007793.3914279.p0 Protein 5e-32 41
Bpet4609 YP_001633227.1 two-component response regulator NC_007622.3794472.p0 Protein 3e-32 41
Bpet4609 YP_001633227.1 two-component response regulator NC_002745.1124361.p0 Protein 5e-32 41
Bpet4609 YP_001633227.1 two-component response regulator NC_009782.5559369.p0 Protein 5e-32 41
Bpet4609 YP_001633227.1 two-component response regulator NC_002951.3237708.p0 Protein 5e-32 41
Bpet4609 YP_001633227.1 two-component response regulator NC_003923.1003749.p0 Protein 4e-32 41
Bpet4609 YP_001633227.1 two-component response regulator NC_002758.1121668.p0 Protein 5e-32 41
Bpet4609 YP_001633227.1 two-component response regulator HE999704.1.gene1528. Protein 2e-32 41
Bpet4609 YP_001633227.1 two-component response regulator CP000034.1.gene3834. Protein 4e-23 41
Bpet4609 YP_001633227.1 two-component response regulator NC_002695.1.915041.p Protein 4e-23 41
Bpet4609 YP_001633227.1 two-component response regulator CP001918.1.gene5135. Protein 8e-21 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bpet4609 YP_001633227.1 two-component response regulator VFG0596 Protein 3e-53 51
Bpet4609 YP_001633227.1 two-component response regulator VFG1389 Protein 2e-37 46
Bpet4609 YP_001633227.1 two-component response regulator VFG1390 Protein 2e-40 45
Bpet4609 YP_001633227.1 two-component response regulator VFG1386 Protein 8e-36 43