Gene Information

Name : Bpet0096 (Bpet0096)
Accession : YP_001628698.1
Strain : Bordetella petrii DSM 12804
Genome accession: NC_010170
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 108039 - 108701 bp
Length : 663 bp
Strand : -
Note : -

DNA sequence :
ATGCGAGTCCTGCTCATCGAAGACGAACCCACGCTGGCCGCGCAGCTGGAACAGGCGCTGCGCGCTGCCGGATACACCGT
AGACCGCGCCGCCGACGGCCAGACCGCGCACTACCTGGGCGACGTGGAAGCTTTCGACGCGGTGGTGCTCGACCTGGGCC
TGCCGGTGCTGGATGGCCTGACCGTTCTCAGGCGCTGGCGGGCGGCGGGGCGCAACATGCCGGTGCTGATCCTGACGGCG
CGCGATAGCTGGCATGAAAAAGTCGCCGGCATCGACGCCGGCGCCGACGACTACCTGGCCAAGCCGTTCCACATGGAAGA
GCTACTGGCGCGCGTGCGCGCCCTGATCCGGCGCAACAGCGTGCATGCCAGCGCCGAATGGCGCTGCGGCCCGCTCATGC
TGGATACCCGCCAGGCCAGGGTGACGCTGGACGGCGCCCCCATTACCCTGACCAGCCACGAGTTCAAGGTGCTGGCCATG
CTTATGCAGCATGCCGGCGAGGTCGTATCGCGCCAGCAATTGGTCGAACATCTCTATGCCCAGGACTTCGACCGCGATTC
CAACACCATCGATGTGTTCATCGGCCGCCTGCGCAAGAAGCTGCCGCCGGACACCATCGAAACCGTGCGCGGGTTGGGCT
ACCGGCTGGCGGGCAATTCATGA

Protein sequence :
MRVLLIEDEPTLAAQLEQALRAAGYTVDRAADGQTAHYLGDVEAFDAVVLDLGLPVLDGLTVLRRWRAAGRNMPVLILTA
RDSWHEKVAGIDAGADDYLAKPFHMEELLARVRALIRRNSVHASAEWRCGPLMLDTRQARVTLDGAPITLTSHEFKVLAM
LMQHAGEVVSRQQLVEHLYAQDFDRDSNTIDVFIGRLRKKLPPDTIETVRGLGYRLAGNS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-23 44
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-22 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bpet0096 YP_001628698.1 two-component response regulator CP004022.1.gene1005. Protein 8e-34 45
Bpet0096 YP_001628698.1 two-component response regulator CP000647.1.gene1136. Protein 4e-32 45
Bpet0096 YP_001628698.1 two-component response regulator CP001918.1.gene2526. Protein 1e-31 45
Bpet0096 YP_001628698.1 two-component response regulator BAC0487 Protein 1e-27 45
Bpet0096 YP_001628698.1 two-component response regulator BAC0530 Protein 3e-32 45
Bpet0096 YP_001628698.1 two-component response regulator BAC0083 Protein 3e-28 44
Bpet0096 YP_001628698.1 two-component response regulator CP000034.1.gene2022. Protein 6e-33 44
Bpet0096 YP_001628698.1 two-component response regulator NC_002695.1.913289.p Protein 8e-32 44
Bpet0096 YP_001628698.1 two-component response regulator NC_002516.2.879194.p Protein 6e-34 44
Bpet0096 YP_001628698.1 two-component response regulator CP001138.1.gene1939. Protein 3e-33 44
Bpet0096 YP_001628698.1 two-component response regulator BAC0638 Protein 5e-20 43
Bpet0096 YP_001628698.1 two-component response regulator BAC0111 Protein 1e-29 41
Bpet0096 YP_001628698.1 two-component response regulator BAC0197 Protein 3e-25 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bpet0096 YP_001628698.1 two-component response regulator VFG0596 Protein 1e-23 44
Bpet0096 YP_001628698.1 two-component response regulator VFG1390 Protein 4e-27 44
Bpet0096 YP_001628698.1 two-component response regulator VFG0475 Protein 3e-33 44
Bpet0096 YP_001628698.1 two-component response regulator VFG0473 Protein 5e-26 41