Gene Information

Name : BcerKBAB4_2492 (BcerKBAB4_2492)
Accession : YP_001645325.1
Strain : Bacillus weihenstephanensis KBAB4
Genome accession: NC_010184
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2566178 - 2566852 bp
Length : 675 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: bca:BCE_2675 DNA-binding response regulator

DNA sequence :
TTGCAACATATACTAATTATTGAGGATGAGGAAAGCTTAGCAGATTTTTTAGAATTAGAATTAAAGTATGAAGGATATAT
AGTAGATATACAACTTGATGGAAGAAAGGGATTAGAAGCAGCACTTGAAAAGAATTACGATCTCATATTACTTGATTTAA
TGTTACCAGGATTAAACGGACTGGAAGTATGTCGTCGACTAAGAGCAACTAAAAGTACACCTATTATTATGTTGACTGCT
CGTGATAGTATTATGGACCGTGTGACAGGGTTAGATAGTGGAGCTGATGATTATCTTCCAAAACCGTTTGCAATTGAAGA
ACTTTTAGCACGTATGAGAGTGATTTTTAGGAGAGAAGAAAATACAGAGCAAAAGCACGCATCATTTCTTTCGTTTAAAG
ATCTACAGCTTCAGATTGAATCTCGAACTATAACTAAAGGAAATGAAGAAATTGAACTTACAAATAAAGAATTCGAGCTA
CTGCTTATGTTTATGAAAAATATTAATCGAGTTCTTACCCGTGATATTTTACTGGACCAAGTATGGGGATATGATGCAAT
GGTTGAGACAAATATAGTCGATGTGTATGTTCGTTATTTACGTAATAAGTTACATAGTGTGGATAAGGAGGAGTATATCC
AAACAGTTCGCGGTGCTGGATATATAATGAAATGA

Protein sequence :
MQHILIIEDEESLADFLELELKYEGYIVDIQLDGRKGLEAALEKNYDLILLDLMLPGLNGLEVCRRLRATKSTPIIMLTA
RDSIMDRVTGLDSGADDYLPKPFAIEELLARMRVIFRREENTEQKHASFLSFKDLQLQIESRTITKGNEEIELTNKEFEL
LLMFMKNINRVLTRDILLDQVWGYDAMVETNIVDVYVRYLRNKLHSVDKEEYIQTVRGAGYIMK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 7e-30 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-29 42
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-27 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-27 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BcerKBAB4_2492 YP_001645325.1 two component transcriptional regulator HE999704.1.gene1528. Protein 8e-53 60
BcerKBAB4_2492 YP_001645325.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 5e-47 52
BcerKBAB4_2492 YP_001645325.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 5e-47 52
BcerKBAB4_2492 YP_001645325.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 5e-47 52
BcerKBAB4_2492 YP_001645325.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 5e-47 52
BcerKBAB4_2492 YP_001645325.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 5e-47 52
BcerKBAB4_2492 YP_001645325.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 5e-47 52
BcerKBAB4_2492 YP_001645325.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 5e-47 52
BcerKBAB4_2492 YP_001645325.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 5e-47 52
BcerKBAB4_2492 YP_001645325.1 two component transcriptional regulator AE015929.1.gene1106. Protein 1e-43 51
BcerKBAB4_2492 YP_001645325.1 two component transcriptional regulator AE016830.1.gene1681. Protein 3e-34 44
BcerKBAB4_2492 YP_001645325.1 two component transcriptional regulator NC_012469.1.7686381. Protein 9e-32 43
BcerKBAB4_2492 YP_001645325.1 two component transcriptional regulator BAC0125 Protein 9e-33 43
BcerKBAB4_2492 YP_001645325.1 two component transcriptional regulator BAC0111 Protein 7e-30 43
BcerKBAB4_2492 YP_001645325.1 two component transcriptional regulator HE999704.1.gene2815. Protein 6e-30 43
BcerKBAB4_2492 YP_001645325.1 two component transcriptional regulator BAC0197 Protein 5e-31 43
BcerKBAB4_2492 YP_001645325.1 two component transcriptional regulator AE000516.2.gene3505. Protein 2e-31 43
BcerKBAB4_2492 YP_001645325.1 two component transcriptional regulator CP001485.1.gene721.p Protein 1e-25 42
BcerKBAB4_2492 YP_001645325.1 two component transcriptional regulator HE999704.1.gene1202. Protein 8e-27 42
BcerKBAB4_2492 YP_001645325.1 two component transcriptional regulator BAC0308 Protein 2e-28 41
BcerKBAB4_2492 YP_001645325.1 two component transcriptional regulator NC_012469.1.7685629. Protein 2e-30 41
BcerKBAB4_2492 YP_001645325.1 two component transcriptional regulator BAC0083 Protein 1e-31 41
BcerKBAB4_2492 YP_001645325.1 two component transcriptional regulator NC_008702.1.4607594. Protein 4e-23 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BcerKBAB4_2492 YP_001645325.1 two component transcriptional regulator VFG1390 Protein 1e-42 45
BcerKBAB4_2492 YP_001645325.1 two component transcriptional regulator VFG0596 Protein 3e-30 42
BcerKBAB4_2492 YP_001645325.1 two component transcriptional regulator VFG0473 Protein 4e-23 41
BcerKBAB4_2492 YP_001645325.1 two component transcriptional regulator VFG1563 Protein 1e-27 41
BcerKBAB4_2492 YP_001645325.1 two component transcriptional regulator VFG1702 Protein 5e-28 41