Gene Information

Name : MAE_22160 (MAE_22160)
Accession : YP_001657230.1
Strain : Microcystis aeruginosa NIES-843
Genome accession: NC_010296
Putative virulence/resistance : Virulence
Product : OmpR family two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1987669 - 1988409 bp
Length : 741 bp
Strand : +
Note : -

DNA sequence :
GTGTTAATTCAGTTGGAGAACCAGAAGGAAAAAATTCTCGTTGTTGATGATGAAGCCAGCATCCGTCGTATCTTAGAGAC
TCGTTTGTCGATGATTGGTTATGAAGTCGTCACCGCCGCCGACGGCGAGGAAGCTTTAGAAACCTTCCGCACCGCCGAAC
CCGATTTAGTGGTTTTGGATGTGATGATGCCGAAATTAGACGGTTACGGTGTCTGTCAGGAACTCCGCAAAGAATCGGAT
ATTCCTATCATTATGTTAACGGCTTTGGGGGATGTGGCCGATCGAATTACCGGGCTAGAATTGGGTGCCGATGACTATGT
AGTTAAACCTTTTTCTCCCAAAGAACTCGAAGCGCGGATTCGTTCGGTGTTGCGTCGGGTAGAGAAAAATGGCGTCCCGG
GGATTCCCAGTTCTGGTGTGATTCATATCGGTTCAATTAAAATCGATACCAATAAACGCCAAGTTTATAAGGGGGATGAA
CGCATCCGTCTGACCGGTATGGAATTTAGTTTACTAGAATTATTGGTCAGTCGATCGGGAGAAGCTTTTTCGCGCTCGGA
AATCCTTCAGGAAGTTTGGGGTTATACCCCCGAACGTCATGTGGATACGCGGGTGGTAGATGTGCATATTTCCCGTTTAC
GAGCCAAATTAGAGGATGATCCCAGCAATCCTGAGTTAATTCTCACCGCTAGAGGTACAGGCTATCTTTTTCAACGTATT
CTAGAACCAGACGAGGAATAG

Protein sequence :
MLIQLENQKEKILVVDDEASIRRILETRLSMIGYEVVTAADGEEALETFRTAEPDLVVLDVMMPKLDGYGVCQELRKESD
IPIIMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSVLRRVEKNGVPGIPSSGVIHIGSIKIDTNKRQVYKGDE
RIRLTGMEFSLLELLVSRSGEAFSRSEILQEVWGYTPERHVDTRVVDVHISRLRAKLEDDPSNPELILTARGTGYLFQRI
LEPDEE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-30 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 8e-30 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
MAE_22160 YP_001657230.1 OmpR family two-component response regulator NC_002952.2859905.p0 Protein 5e-48 51
MAE_22160 YP_001657230.1 OmpR family two-component response regulator NC_007793.3914279.p0 Protein 4e-48 51
MAE_22160 YP_001657230.1 OmpR family two-component response regulator NC_007622.3794472.p0 Protein 4e-48 51
MAE_22160 YP_001657230.1 OmpR family two-component response regulator NC_002745.1124361.p0 Protein 4e-48 51
MAE_22160 YP_001657230.1 OmpR family two-component response regulator NC_009782.5559369.p0 Protein 4e-48 51
MAE_22160 YP_001657230.1 OmpR family two-component response regulator NC_002951.3237708.p0 Protein 4e-48 51
MAE_22160 YP_001657230.1 OmpR family two-component response regulator NC_002758.1121668.p0 Protein 4e-48 51
MAE_22160 YP_001657230.1 OmpR family two-component response regulator NC_009641.5332272.p0 Protein 4e-48 51
MAE_22160 YP_001657230.1 OmpR family two-component response regulator NC_013450.8614421.p0 Protein 4e-48 51
MAE_22160 YP_001657230.1 OmpR family two-component response regulator NC_003923.1003749.p0 Protein 5e-48 50
MAE_22160 YP_001657230.1 OmpR family two-component response regulator NC_012469.1.7685629. Protein 7e-44 47
MAE_22160 YP_001657230.1 OmpR family two-component response regulator HE999704.1.gene2815. Protein 3e-42 47
MAE_22160 YP_001657230.1 OmpR family two-component response regulator BAC0125 Protein 2e-39 45
MAE_22160 YP_001657230.1 OmpR family two-component response regulator AE000516.2.gene3505. Protein 2e-43 45
MAE_22160 YP_001657230.1 OmpR family two-component response regulator CP000034.1.gene3671. Protein 7e-40 45
MAE_22160 YP_001657230.1 OmpR family two-component response regulator BAC0197 Protein 1e-34 43
MAE_22160 YP_001657230.1 OmpR family two-component response regulator CP000675.2.gene1535. Protein 6e-38 42
MAE_22160 YP_001657230.1 OmpR family two-component response regulator BAC0083 Protein 4e-36 42
MAE_22160 YP_001657230.1 OmpR family two-component response regulator CP001918.1.gene5135. Protein 3e-25 42
MAE_22160 YP_001657230.1 OmpR family two-component response regulator BAC0638 Protein 2e-28 42
MAE_22160 YP_001657230.1 OmpR family two-component response regulator NC_010079.5776364.p0 Protein 2e-36 41
MAE_22160 YP_001657230.1 OmpR family two-component response regulator NC_002952.2859858.p0 Protein 2e-36 41
MAE_22160 YP_001657230.1 OmpR family two-component response regulator NC_007622.3794948.p0 Protein 2e-36 41
MAE_22160 YP_001657230.1 OmpR family two-component response regulator NC_003923.1003417.p0 Protein 2e-36 41
MAE_22160 YP_001657230.1 OmpR family two-component response regulator NC_013450.8614146.p0 Protein 2e-36 41
MAE_22160 YP_001657230.1 OmpR family two-component response regulator NC_002951.3238224.p0 Protein 2e-36 41
MAE_22160 YP_001657230.1 OmpR family two-component response regulator NC_007793.3914065.p0 Protein 2e-36 41
MAE_22160 YP_001657230.1 OmpR family two-component response regulator NC_002758.1121390.p0 Protein 2e-36 41
MAE_22160 YP_001657230.1 OmpR family two-component response regulator HE999704.1.gene1528. Protein 1e-30 41
MAE_22160 YP_001657230.1 OmpR family two-component response regulator CP001485.1.gene721.p Protein 2e-33 41
MAE_22160 YP_001657230.1 OmpR family two-component response regulator DQ212986.1.gene4.p01 Protein 1e-32 41
MAE_22160 YP_001657230.1 OmpR family two-component response regulator CP004022.1.gene3215. Protein 2e-33 41
MAE_22160 YP_001657230.1 OmpR family two-component response regulator NC_012469.1.7686381. Protein 1e-40 41
MAE_22160 YP_001657230.1 OmpR family two-component response regulator AE016830.1.gene1681. Protein 1e-39 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
MAE_22160 YP_001657230.1 OmpR family two-component response regulator VFG1390 Protein 5e-40 43
MAE_22160 YP_001657230.1 OmpR family two-component response regulator VFG0596 Protein 7e-31 43
MAE_22160 YP_001657230.1 OmpR family two-component response regulator VFG1389 Protein 4e-33 43