Gene Information

Name : Teth39_0274 (Teth39_0274)
Accession : YP_001664279.1
Strain : Thermoanaerobacter pseudethanolicus ATCC 33223
Genome accession: NC_010321
Putative virulence/resistance : Resistance
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 308503 - 309198 bp
Length : 696 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein

DNA sequence :
ATGGGTAAAAAGATATTTGTTGTTGATGACGAAATAAAAATACTGGAAGTTGTAAAGTCATATCTTGAACATGAGGGATT
TAGCGTTATTACCGAAACCAATGGCAATAACGTTTTAAATACATTCAAAAAAGAAAAACCGGATCTTGTTATACTTGATC
TTATGTTGCCAGGTATTTCAGGAGAGGAACTGTGCAAGAGGATACGGCAGTTTTCCAATGTTCCGATATTGATGCTTACA
GCAAAAGTTCAAGAAAGTGATAAAATTAATGGATTTTCTATAGGTGCTGATGACTATCTTACAAAACCATTCAGCCCACG
TGAATTGGTTATGAGAGTAAAGGCAATATTAAGGAGGACAAGTGATGATGTACCTCTTGCTGAAGTAATGTCTTTTAATA
ATGATGACCTTGTGGTCGATTTTAAAGCACACACGGTGAAGAAAAAAGGAGTAGTTGTAAATCTCACTCCAAACGAATTT
AAAATTTTAAAGTTTTTAATTCGCAATCCTAACAGAGTCTTTACAAGAGAAGAATTAATTGAAAAAGTTATGGGATTTGA
CTATGAAGGCTATGACAGGACGATTGATGCACATATTAAAAATTTAAGACAAAAAATTGAAGACGATACGAAAAATCCAG
TGTATATTAAAACGGTGTATGGTGTTGGATATAAATTTGGTGATGGAAATGTTTAG

Protein sequence :
MGKKIFVVDDEIKILEVVKSYLEHEGFSVITETNGNNVLNTFKKEKPDLVILDLMLPGISGEELCKRIRQFSNVPILMLT
AKVQESDKINGFSIGADDYLTKPFSPRELVMRVKAILRRTSDDVPLAEVMSFNNDDLVVDFKAHTVKKKGVVVNLTPNEF
KILKFLIRNPNRVFTREELIEKVMGFDYEGYDRTIDAHIKNLRQKIEDDTKNPVYIKTVYGVGYKFGDGNV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
vanRB YP_001698483.1 regulatory protein Not tested Not named Protein 7e-31 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Teth39_0274 YP_001664279.1 two component transcriptional regulator NC_012469.1.7685629. Protein 9e-40 47
Teth39_0274 YP_001664279.1 two component transcriptional regulator HE999704.1.gene2815. Protein 1e-43 47
Teth39_0274 YP_001664279.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 5e-43 45
Teth39_0274 YP_001664279.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 6e-43 45
Teth39_0274 YP_001664279.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 6e-43 45
Teth39_0274 YP_001664279.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 5e-43 45
Teth39_0274 YP_001664279.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 6e-43 45
Teth39_0274 YP_001664279.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 6e-43 45
Teth39_0274 YP_001664279.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 6e-43 45
Teth39_0274 YP_001664279.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 6e-43 45
Teth39_0274 YP_001664279.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 1e-42 45
Teth39_0274 YP_001664279.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 6e-43 45
Teth39_0274 YP_001664279.1 two component transcriptional regulator NC_012469.1.7686381. Protein 1e-41 44
Teth39_0274 YP_001664279.1 two component transcriptional regulator AF162694.1.orf4.gene Protein 4e-36 44
Teth39_0274 YP_001664279.1 two component transcriptional regulator AE000516.2.gene3505. Protein 2e-38 44
Teth39_0274 YP_001664279.1 two component transcriptional regulator AE016830.1.gene1681. Protein 7e-38 43
Teth39_0274 YP_001664279.1 two component transcriptional regulator NC_005054.2598277.p0 Protein 5e-38 43
Teth39_0274 YP_001664279.1 two component transcriptional regulator NC_014475.1.orf0.gen Protein 5e-38 43
Teth39_0274 YP_001664279.1 two component transcriptional regulator AM180355.1.gene1830. Protein 4e-38 43
Teth39_0274 YP_001664279.1 two component transcriptional regulator EU250284.1.orf4.gene Protein 1e-33 43
Teth39_0274 YP_001664279.1 two component transcriptional regulator CP001918.1.gene3444. Protein 9e-47 43
Teth39_0274 YP_001664279.1 two component transcriptional regulator CP000675.2.gene1535. Protein 9e-41 42
Teth39_0274 YP_001664279.1 two component transcriptional regulator DQ212986.1.gene4.p01 Protein 9e-40 42
Teth39_0274 YP_001664279.1 two component transcriptional regulator AF130997.1.orf0.gene Protein 7e-34 42
Teth39_0274 YP_001664279.1 two component transcriptional regulator CP001138.1.gene2239. Protein 3e-45 42
Teth39_0274 YP_001664279.1 two component transcriptional regulator BAC0596 Protein 3e-45 42
Teth39_0274 YP_001664279.1 two component transcriptional regulator CP000647.1.gene2531. Protein 1e-46 42
Teth39_0274 YP_001664279.1 two component transcriptional regulator CP000034.1.gene2186. Protein 9e-47 42
Teth39_0274 YP_001664279.1 two component transcriptional regulator NC_002695.1.916589.p Protein 6e-47 42
Teth39_0274 YP_001664279.1 two component transcriptional regulator BAC0039 Protein 9e-47 42
Teth39_0274 YP_001664279.1 two component transcriptional regulator AF155139.2.orf0.gene Protein 1e-35 41