Gene Information

Name : MAB_1926 (MAB_1926)
Accession : YP_001702663.1
Strain : Mycobacterium abscessus ATCC 19977
Genome accession: NC_010397
Putative virulence/resistance : Virulence
Product : Putative transcriptional regulatory protein PrrA
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1926912 - 1927622 bp
Length : 711 bp
Strand : +
Note : Similar to Q273Z4_MYCFV 1e-86

DNA sequence :
ATGACACAGGAAACTACCGCCCGTCACAAGGTGTTGATGGTCGATGACGACCCGGACGTTCGGAACTCGGTAGCCCGCGG
GCTACGCCACTCGGGTTTCGACGTCCGGGTCGCCGTTGATGGCCGCGACGCGCTCACCCAGCTCGCGGCCGATGAGCCCG
ATGCCCTGGTACTCGACGTGCAGATGCCCGAGCTGGACGGGGTTGCGGTGGTCACCGCTCTGCGGGCCCTGGGTAACGAC
ATTCCGATCTGCGTGCTCAGTGCACGCGACACCGTCAACGACCGAATCGCCGGCTTGGAGGCCGGTGCCGACGACTACTT
GACCAAACCCTTTGACCTCGGCGAGCTGGTGGCTCGCCTGCGTGCGCTGCTGCGCCGTCGCGGCGCCGGTTCGGGCGGCC
TCGCCGATTCCGCCATCACCGTCGGACAGATCACCGTGGACGTGTCGCGCCGCTTGGTCTTTGTCAACGGAGAACGTGTC
GAGCTGAGTAAGCGGGAGTTCGATCTGCTGGTGGTGCTGGCCGAGAACACCGGTGTGGTGCTGAGCCGCACCCGGCTGCT
GGAATTGGTGTGGGGGTACGACTTTGACGTCGAGACCAATGTTGCCGATGTCTTCGTCAGCTATCTGCGCCGCAAGCTGG
AAGCTGGGGGAGCCGCGCGAGTCATCCATACCGTCAGGGGAGTCGGCTACGTGATGCGGGAAGAGCCGTGA

Protein sequence :
MTQETTARHKVLMVDDDPDVRNSVARGLRHSGFDVRVAVDGRDALTQLAADEPDALVLDVQMPELDGVAVVTALRALGND
IPICVLSARDTVNDRIAGLEAGADDYLTKPFDLGELVARLRALLRRRGAGSGGLADSAITVGQITVDVSRRLVFVNGERV
ELSKREFDLLVVLAENTGVVLSRTRLLELVWGYDFDVETNVADVFVSYLRRKLEAGGAARVIHTVRGVGYVMREEP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-27 41
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-27 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
MAB_1926 YP_001702663.1 Putative transcriptional regulatory protein PrrA HE999704.1.gene1528. Protein 3e-37 42
MAB_1926 YP_001702663.1 Putative transcriptional regulatory protein PrrA BAC0308 Protein 2e-31 42
MAB_1926 YP_001702663.1 Putative transcriptional regulatory protein PrrA AE000516.2.gene3505. Protein 2e-27 42
MAB_1926 YP_001702663.1 Putative transcriptional regulatory protein PrrA NC_010079.5776364.p0 Protein 3e-31 41
MAB_1926 YP_001702663.1 Putative transcriptional regulatory protein PrrA NC_002952.2859858.p0 Protein 3e-31 41
MAB_1926 YP_001702663.1 Putative transcriptional regulatory protein PrrA NC_007622.3794948.p0 Protein 3e-31 41
MAB_1926 YP_001702663.1 Putative transcriptional regulatory protein PrrA NC_003923.1003417.p0 Protein 3e-31 41
MAB_1926 YP_001702663.1 Putative transcriptional regulatory protein PrrA NC_013450.8614146.p0 Protein 3e-31 41
MAB_1926 YP_001702663.1 Putative transcriptional regulatory protein PrrA NC_002951.3238224.p0 Protein 3e-31 41
MAB_1926 YP_001702663.1 Putative transcriptional regulatory protein PrrA NC_007793.3914065.p0 Protein 3e-31 41
MAB_1926 YP_001702663.1 Putative transcriptional regulatory protein PrrA NC_002758.1121390.p0 Protein 3e-31 41
MAB_1926 YP_001702663.1 Putative transcriptional regulatory protein PrrA BAC0125 Protein 7e-29 41
MAB_1926 YP_001702663.1 Putative transcriptional regulatory protein PrrA NC_002952.2859905.p0 Protein 4e-30 41
MAB_1926 YP_001702663.1 Putative transcriptional regulatory protein PrrA NC_009782.5559369.p0 Protein 3e-30 41
MAB_1926 YP_001702663.1 Putative transcriptional regulatory protein PrrA NC_002951.3237708.p0 Protein 3e-30 41
MAB_1926 YP_001702663.1 Putative transcriptional regulatory protein PrrA NC_007622.3794472.p0 Protein 4e-30 41
MAB_1926 YP_001702663.1 Putative transcriptional regulatory protein PrrA NC_003923.1003749.p0 Protein 3e-30 41
MAB_1926 YP_001702663.1 Putative transcriptional regulatory protein PrrA NC_002758.1121668.p0 Protein 3e-30 41
MAB_1926 YP_001702663.1 Putative transcriptional regulatory protein PrrA NC_009641.5332272.p0 Protein 3e-30 41
MAB_1926 YP_001702663.1 Putative transcriptional regulatory protein PrrA NC_013450.8614421.p0 Protein 3e-30 41
MAB_1926 YP_001702663.1 Putative transcriptional regulatory protein PrrA NC_007793.3914279.p0 Protein 3e-30 41
MAB_1926 YP_001702663.1 Putative transcriptional regulatory protein PrrA NC_002745.1124361.p0 Protein 3e-30 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
MAB_1926 YP_001702663.1 Putative transcriptional regulatory protein PrrA VFG1389 Protein 1e-55 60
MAB_1926 YP_001702663.1 Putative transcriptional regulatory protein PrrA VFG1390 Protein 1e-44 50
MAB_1926 YP_001702663.1 Putative transcriptional regulatory protein PrrA VFG1386 Protein 4e-37 46
MAB_1926 YP_001702663.1 Putative transcriptional regulatory protein PrrA VFG0596 Protein 4e-28 41