Gene Information

Name : MAB_0956c (MAB_0956c)
Accession : YP_001701702.1
Strain : Mycobacterium abscessus ATCC 19977
Genome accession: NC_010397
Putative virulence/resistance : Virulence
Product : Probable transcriptional regulatory protein PrrA
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 964126 - 964827 bp
Length : 702 bp
Strand : -
Note : Similar to PRRA_MYCTU 5e-95

DNA sequence :
ATGGTTGATGGGCAGGGCTCCCCGCGCGTACTGGTGGTGGACGACGACGCCGACGTGCTCGCCTCGCTGGAACGCGGCCT
GCGCCTCTCCGGATTCGAGGTGAATACCGCCAGCGACGGCGCCGAGGCGCTGCGCTGCGCCACCGAACACCGTCCGGACG
CGATAGTGCTCGATATCAACATGCCGGTGCTGGACGGTGTCAGTGTGGTGACCGCGTTGCGCGCGATGGACAACGACGTA
CCGGTCTGTGTGCTCTCCGCACGCACCTCGGTCGACGATCGGGTCGCCGGCCTGGAGGCCGGTGCCGACGACTATCTGAC
CAAGCCGTTCGTGCTCGCCGAGTTGGTGGCCCGCGTCAAAGCGCTGCTGCGCCGCCGCGGCGCAGTAGCCACGTCGTCGA
CGGAAACCATCACCGTGGGGCCCCTGGAGGTGGAGATTCCGGGCCGGCGCGCCCGCATCAACGGTGTCGAGGTCGATCTC
ACCAAACGCGAGTTCGATCTGCTGGCGGTACTGGCCGAACACAAGACCGCGGTGCTGTCACGCGCCCAGCTGCTGGAGCT
GGTGTGGGGCTACGACTTTGCCGCCGACACCAACGTCGTCGACGTGTTCATCGGTTACCTGCGCCGCAAGCTGGAGGCCG
GCGGTGCACCCCGGCTGTTGCACACCGTGCGCGGTGTCGGGTTCGTGCTGCGTTCGCAGTAG

Protein sequence :
MVDGQGSPRVLVVDDDADVLASLERGLRLSGFEVNTASDGAEALRCATEHRPDAIVLDINMPVLDGVSVVTALRAMDNDV
PVCVLSARTSVDDRVAGLEAGADDYLTKPFVLAELVARVKALLRRRGAVATSSTETITVGPLEVEIPGRRARINGVEVDL
TKREFDLLAVLAEHKTAVLSRAQLLELVWGYDFAADTNVVDVFIGYLRRKLEAGGAPRLLHTVRGVGFVLRSQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-25 41
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-24 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
MAB_0956c YP_001701702.1 Probable transcriptional regulatory protein PrrA BAC0083 Protein 5e-30 44
MAB_0956c YP_001701702.1 Probable transcriptional regulatory protein PrrA AE000516.2.gene3505. Protein 2e-28 44
MAB_0956c YP_001701702.1 Probable transcriptional regulatory protein PrrA NC_012469.1.7685629. Protein 1e-26 43
MAB_0956c YP_001701702.1 Probable transcriptional regulatory protein PrrA BAC0125 Protein 2e-29 42
MAB_0956c YP_001701702.1 Probable transcriptional regulatory protein PrrA HE999704.1.gene1528. Protein 3e-30 42
MAB_0956c YP_001701702.1 Probable transcriptional regulatory protein PrrA BAC0197 Protein 1e-24 42
MAB_0956c YP_001701702.1 Probable transcriptional regulatory protein PrrA NC_003923.1003417.p0 Protein 3e-32 41
MAB_0956c YP_001701702.1 Probable transcriptional regulatory protein PrrA NC_013450.8614146.p0 Protein 3e-32 41
MAB_0956c YP_001701702.1 Probable transcriptional regulatory protein PrrA NC_002951.3238224.p0 Protein 3e-32 41
MAB_0956c YP_001701702.1 Probable transcriptional regulatory protein PrrA NC_007793.3914065.p0 Protein 3e-32 41
MAB_0956c YP_001701702.1 Probable transcriptional regulatory protein PrrA NC_002758.1121390.p0 Protein 3e-32 41
MAB_0956c YP_001701702.1 Probable transcriptional regulatory protein PrrA NC_010079.5776364.p0 Protein 3e-32 41
MAB_0956c YP_001701702.1 Probable transcriptional regulatory protein PrrA NC_002952.2859858.p0 Protein 3e-32 41
MAB_0956c YP_001701702.1 Probable transcriptional regulatory protein PrrA NC_007622.3794948.p0 Protein 3e-32 41
MAB_0956c YP_001701702.1 Probable transcriptional regulatory protein PrrA NC_012469.1.7686381. Protein 8e-23 41
MAB_0956c YP_001701702.1 Probable transcriptional regulatory protein PrrA BAC0111 Protein 1e-25 41
MAB_0956c YP_001701702.1 Probable transcriptional regulatory protein PrrA NC_002952.2859905.p0 Protein 2e-26 41
MAB_0956c YP_001701702.1 Probable transcriptional regulatory protein PrrA NC_003923.1003749.p0 Protein 3e-26 41
MAB_0956c YP_001701702.1 Probable transcriptional regulatory protein PrrA NC_002758.1121668.p0 Protein 3e-26 41
MAB_0956c YP_001701702.1 Probable transcriptional regulatory protein PrrA NC_007622.3794472.p0 Protein 2e-26 41
MAB_0956c YP_001701702.1 Probable transcriptional regulatory protein PrrA NC_009641.5332272.p0 Protein 3e-26 41
MAB_0956c YP_001701702.1 Probable transcriptional regulatory protein PrrA NC_013450.8614421.p0 Protein 3e-26 41
MAB_0956c YP_001701702.1 Probable transcriptional regulatory protein PrrA NC_007793.3914279.p0 Protein 3e-26 41
MAB_0956c YP_001701702.1 Probable transcriptional regulatory protein PrrA NC_002745.1124361.p0 Protein 3e-26 41
MAB_0956c YP_001701702.1 Probable transcriptional regulatory protein PrrA NC_009782.5559369.p0 Protein 3e-26 41
MAB_0956c YP_001701702.1 Probable transcriptional regulatory protein PrrA NC_002951.3237708.p0 Protein 3e-26 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
MAB_0956c YP_001701702.1 Probable transcriptional regulatory protein PrrA VFG1389 Protein 2e-80 92
MAB_0956c YP_001701702.1 Probable transcriptional regulatory protein PrrA VFG1390 Protein 1e-41 50
MAB_0956c YP_001701702.1 Probable transcriptional regulatory protein PrrA VFG1386 Protein 6e-36 45
MAB_0956c YP_001701702.1 Probable transcriptional regulatory protein PrrA VFG0596 Protein 2e-25 41