Gene Information

Name : tetA (ABAYE3637)
Accession : YP_001715369.1
Strain : Acinetobacter baumannii AYE
Genome accession: NC_010410
Putative virulence/resistance : Resistance
Product : tetracycline resistance protein, class G (TETA(G))
Function : -
COG functional category : G : Carbohydrate transport and metabolism
COG ID : COG2814
EC number : -
Position : 3671432 - 3672607 bp
Length : 1176 bp
Strand : -
Note : Evidence 2a : Function of homologous gene experimentally demonstrated in an other organism; Product type t : transporter

DNA sequence :
GTGCGCAGCTCTGCCATCATTGCCCTGCTGATCGTGGGTCTTGACGCCATGGGTCTCGGCCTCATCATGCCCGTCCTTCC
GACGCTTCTGCGTGAGCTTGTGCCAGCAGAGCAGGTCGCTGGACACTATGGTGCCTTGCTGTCGCTCTATGCATTGATGC
AGGTCGTCTTCGCGCCCATGCTTGGACAGCTTTCGGATTCTTACGGTCGGCGTCCGGTACTTCTGGCTTCTCTTGCAGGA
GCCGCAGTCGATTACACGATTATGGCATCAGCGCCGGTCTTATGGGTGCTCTATATCGGCCGACTCGTGTCCGGCGTCAC
GGGCGCAACCGGAGCTGTAGCAGCCTCAACCATTGCCGATTCGACGGGGGAAGGTTCTCGCGCACGCTGGTTCGGCTACA
TGGGGGCCTGTTATGGGGCGGGCATGATTGCCGGGCCAGCACTTGGTGGCATGCTCGGTGGTATCTCTGCTCATGCCCCG
TTTATCGCCGCCGCCCTTCTCAACGGGTTCGCGTTCCTGCTTGCCTGCATTTTCCTCAAGGAGACTCATCACAGCCATGG
CGGGACCGGAAAGCCGGTTCGCATCAAACCATTCGTTCTGTTACGGCTGGATGATGCATTGCGCGGGCTAGGTGCGCTTT
TCGCAGTTTTCTTCATTATTCAACTGATCGGCCAAGTGCCTGCAGCCCTATGGGTCATATATGGCGAGGACCGTTTTCAG
TGGAACACCGCGACCGTTGGTTTGTCGCTCGCGGCGTTTGGGGCAACACATGCGATCTTCCAAGCGTTTGTTACCGGCCC
GCTTTCAAGCCGGCTTGGAGAGCGGCGCACGCTGCTGTTTGGCATGGCTGCGGATGCGACTGGCTTCGTTCTTCTGGCTT
TTGCCACGCAGGGATGGATGGTGTTCCCGATTCTGTTGCTGCTTGCCGCCGGGGGTGTTGGCATGCCGGCCTTGCAGGCA
ATGCTCTCAAACAATGTCAGCAGTAACAAGCAAGGGGCTTTGCAAGGAACGCTAACGAGCCTCACCAATCTAAGCTCTAT
CGCAGGACCGCTTGGCTTCACAGCACTCTATTCTGCCACCGCCGGGGCATGGAACGGTTGGGTTTGGATTGTCGGCGCGA
TCCTCTATTTAATATGTCTGCCAATACTACGCAGACCATTCGCAACTTCATTGTGA

Protein sequence :
MRSSAIIALLIVGLDAMGLGLIMPVLPTLLRELVPAEQVAGHYGALLSLYALMQVVFAPMLGQLSDSYGRRPVLLASLAG
AAVDYTIMASAPVLWVLYIGRLVSGVTGATGAVAASTIADSTGEGSRARWFGYMGACYGAGMIAGPALGGMLGGISAHAP
FIAAALLNGFAFLLACIFLKETHHSHGGTGKPVRIKPFVLLRLDDALRGLGALFAVFFIIQLIGQVPAALWVIYGEDRFQ
WNTATVGLSLAAFGATHAIFQAFVTGPLSSRLGERRTLLFGMAADATGFVLLAFATQGWMVFPILLLLAAGGVGMPALQA
MLSNNVSSNKQGALQGTLTSLTNLSSIAGPLGFTALYSATAGAWNGWVWIVGAILYLICLPILRRPFATSL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
tet(G) AAK02051.1 tetracycline resistance protein Not tested SGI1 Protein 3e-146 100
tetA(G) ABZ01843.1 TetA(G) Not tested SGI2 Protein 3e-146 100
tetA(G) AGK06974.1 TetA(G) Not tested SGI1 Protein 3e-146 100
tetA(G) AGK07104.1 TetA(G) Not tested SGI1 Protein 3e-146 100
tetA CAJ77034.1 Tetracycline resistance protein Not tested AbaR1 Protein 8e-153 100
tetA YP_006098396.1 tetracycline resistance protein Not tested Tn2411 Protein 1e-101 63
tetA(A) ACK44537.1 TetA(A) Not tested SGI1 Protein 1e-101 63
tetA(A) AGK07027.1 TetA(A) Not tested SGI1 Protein 1e-101 63
tetA(A) AGK07085.1 TetA(A) Not tested SGI1 Protein 1e-101 63
tetA CAJ77066.1 Tetracycline resistance protein Not tested AbaR1 Protein 6e-102 63
tetA(A) ACN81011.1 TetA(A) Not tested AbaR5 Protein 8e-102 63
tetA(B) AAL08445.1 tetracycline resistance protein TetA(B) Not tested SRL Protein 4e-85 52
tetB AEA34667.1 tetracycline resistance determinant Not tested Not named Protein 4e-85 51
tetA(B) AEZ06045.1 tetracycline efflux protein Not tested Tn6167 Protein 5e-85 51
BJAB07104_00277 YP_008207742.1 Permeases of the major facilitator superfamily Not tested AbaR25 Protein 1e-84 51
BJAB0868_00281 YP_008211607.1 Permeases of the major facilitator superfamily Not tested AbaR26 Protein 1e-84 51
tetA(B) AEQ20905.1 tetracycline resistance protein Not tested Tn6166 Protein 1e-84 51
tetA YP_005797160.1 tetracycline resistance protein, class G (TETA(G)) Not tested AbaR4e Protein 8e-83 51
ABZJ_00260 YP_005524216.1 Tetracycline resistance protein, class B (TETA(B) ) (Metal-tetracycline/H(+) antiporter) Not tested AbaR22 Protein 8e-85 51
tetA(B) AFH57202.1 tetracycline resistance protein Not tested AbaR4a Protein 8e-85 51
tet(H) YP_005176248.1 tetracycline efflux protein, class H Not tested ICEPmu1 Protein 4e-72 50

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
tetA YP_001715369.1 tetracycline resistance protein, class G (TETA(G)) AF133140.gene.p01 Protein 5e-153 100
tetA YP_001715369.1 tetracycline resistance protein, class G (TETA(G)) NC_010410.6002612.p0 Protein 5e-153 100
tetA YP_001715369.1 tetracycline resistance protein, class G (TETA(G)) AF133139.gene.p01 Protein 8e-146 95
tetA YP_001715369.1 tetracycline resistance protein, class G (TETA(G)) AF070999.gene.p01 Protein 2e-100 63
tetA YP_001715369.1 tetracycline resistance protein, class G (TETA(G)) NC_011586.7045189.p0 Protein 3e-97 63
tetA YP_001715369.1 tetracycline resistance protein, class G (TETA(G)) NC_010410.6002597.p0 Protein 4e-102 63
tetA YP_001715369.1 tetracycline resistance protein, class G (TETA(G)) CP001485.1.gene2821. Protein 4e-102 63
tetA YP_001715369.1 tetracycline resistance protein, class G (TETA(G)) AF534183.gene.p01 Protein 3e-102 63
tetA YP_001715369.1 tetracycline resistance protein, class G (TETA(G)) X75761.gene.p01 Protein 3e-101 62
tetA YP_001715369.1 tetracycline resistance protein, class G (TETA(G)) Y19114.gene.p01 Protein 3e-97 59
tetA YP_001715369.1 tetracycline resistance protein, class G (TETA(G)) Y19116.gene.p01 Protein 4e-84 57
tetA YP_001715369.1 tetracycline resistance protein, class G (TETA(G)) L06940.gene.p01 Protein 1e-85 56
tetA YP_001715369.1 tetracycline resistance protein, class G (TETA(G)) L06798.gene.p01 Protein 4e-79 52
tetA YP_001715369.1 tetracycline resistance protein, class G (TETA(G)) AY264780.2.gene3.p01 Protein 9e-79 52
tetA YP_001715369.1 tetracycline resistance protein, class G (TETA(G)) NC_010558.1.6275971. Protein 3e-85 52
tetA YP_001715369.1 tetracycline resistance protein, class G (TETA(G)) V00611.gene.p01 Protein 3e-84 51
tetA YP_001715369.1 tetracycline resistance protein, class G (TETA(G)) AB084246.gene.p01 Protein 4e-85 51
tetA YP_001715369.1 tetracycline resistance protein, class G (TETA(G)) AF038993.gene.p01 Protein 6e-73 50
tetA YP_001715369.1 tetracycline resistance protein, class G (TETA(G)) CP004022.1.gene2534. Protein 1e-72 50
tetA YP_001715369.1 tetracycline resistance protein, class G (TETA(G)) AJ250203.gene.p01 Protein 3e-73 50
tetA YP_001715369.1 tetracycline resistance protein, class G (TETA(G)) Y15510.gene.p01 Protein 6e-73 50
tetA YP_001715369.1 tetracycline resistance protein, class G (TETA(G)) AY743590.gene.p01 Protein 2e-73 49
tetA YP_001715369.1 tetracycline resistance protein, class G (TETA(G)) AF121000.gene.p01 Protein 2e-66 46
tetA YP_001715369.1 tetracycline resistance protein, class G (TETA(G)) AJ420072.gene.p01 Protein 1e-63 45
tetA YP_001715369.1 tetracycline resistance protein, class G (TETA(G)) AF090987.gene.p01 Protein 3e-51 43
tetA YP_001715369.1 tetracycline resistance protein, class G (TETA(G)) NC_009085.4918440.p0 Protein 4e-46 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
tetA YP_001715369.1 tetracycline resistance protein, class G (TETA(G)) VFG1036 Protein 3e-85 52