Gene Information

Name : tetR (ABAYE3639)
Accession : YP_001715370.1
Strain : Acinetobacter baumannii AYE
Genome accession: NC_010410
Putative virulence/resistance : Virulence
Product : tetracycline repressor protein class G
Function : -
COG functional category : K : Transcription
COG ID : COG1309
EC number : -
Position : 3672711 - 3673337 bp
Length : 627 bp
Strand : +
Note : Evidence 2a : Function of homologous gene experimentally demonstrated in an other organism; Product type r : regulator

DNA sequence :
ATGACCAAACTGGACAAGGGCACCGTGATCGCGGCGGCGCTAGAGCTGTTGAACGAGGTTGGCATGGACAGCCTGACGAC
GCGGAAGCTCGCTGAACGCCTCAAGGTTCAGCAGCCTGCGCTTTACTGGCATTTCCAGAACAAGCGAGCGCTGCTTGATG
CGCTCGCCGAGGCGATGCTGGCGGAACGCCATACCCGCTCGCTACCCGAAGAGAATGAGGACTGGCGGGTGTTCCTGAAA
GAGAATGCCCTGAGCTTCAGAACGGCGTTGCTCTCTTATCGGGACGGCGCGCGTATCCATGCCGGCACTCGACCGACAGA
ACCGAATTTTGGCACCGCCGAGACGCAAATACGCTTTCTCTGCGCGGAGGGCTTTTGTCCGAAGCGCGCCGTTTGGGCGC
TCCGGGCGGTCAGTCACTATGTGGTCGGTTCCGTTCTCGAGCAGCAGGCATCTGATGCCGATGAGAGAGTTCCGGACAGG
CCAGATGTGTCCGAGCAAGCACCGTCGTCCTTCCTGCACGATCTGTTTCACGAGTTGGAAACAGACGGCATGGATGCTGC
GTTCAACTTCGGACTCGACAGCCTCATCGCTGGTTTCGAGCGGCTGCGTTCATCTACAACAGATTAG

Protein sequence :
MTKLDKGTVIAAALELLNEVGMDSLTTRKLAERLKVQQPALYWHFQNKRALLDALAEAMLAERHTRSLPEENEDWRVFLK
ENALSFRTALLSYRDGARIHAGTRPTEPNFGTAETQIRFLCAEGFCPKRAVWALRAVSHYVVGSVLEQQASDADERVPDR
PDVSEQAPSSFLHDLFHELETDGMDAAFNFGLDSLIAGFERLRSSTTD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
tetR AAK02050.1 tetracycline resistance regulator protein Not tested SGI1 Protein 1e-86 100
tetR ABZ01841.1 TetR Not tested SGI2 Protein 1e-86 100
tetR CAJ77033.1 Tetracycline repressor protein Not tested AbaR1 Protein 1e-86 100
tetR(G) AGK06973.1 TetR(G) Not tested SGI1 Protein 1e-86 100
tetR(G) AGK07103.1 TetR(G) Not tested SGI1 Protein 1e-86 100
tetR YP_006098395.1 tetracycline repressor Not tested Tn2411 Protein 2e-47 61
tetR(A) AGK07026.1 TetR(A) Not tested SGI1 Protein 1e-47 61
tetR(A) AGK07084.1 TetR(A) Not tested SGI1 Protein 1e-47 61
tetR(A) ACK44536.1 TetR(A) Not tested SGI1 Protein 1e-47 61
tetR(A) ACN81010.1 repressor protein Not tested AbaR5 Protein 1e-47 61
tetR CAJ77065.1 Tetracycline repressor protein Not tested AbaR1 Protein 8e-48 61
tetR1 YP_005176239.1 tetracycline repressor protein Not tested ICEPmu1 Protein 4e-44 51
tetR2 YP_005176247.1 tetracycline repressor protein Not tested ICEPmu1 Protein 4e-44 51
tetR AAL08444.1 tet repressor Not tested SRL Protein 2e-39 50
BJAB07104_00278 YP_008207743.1 Transcriptional regulator Not tested AbaR25 Protein 1e-40 49
BJAB0868_00282 YP_008211608.1 Transcriptional regulator Not tested AbaR26 Protein 1e-40 49
tetR AEA34668.1 tetracycline repressor protein Not tested Not named Protein 8e-41 49
ABZJ_00261 YP_005524217.1 tetracycline repressor protein TetR Not tested AbaR22 Protein 1e-40 49
tetR YP_005797161.1 tetracycline repressor protein class G Not tested AbaR4e Protein 1e-40 49
tetR(B) AEQ20906.1 tetracycline repressor protein Not tested Tn6166 Protein 1e-40 49
tetR AFH57203.1 repression protein Not tested AbaR4a Protein 9e-41 49
tetR(B) AEZ06046.1 repressor protein Not tested Tn6167 Protein 1e-40 49
tetR AFV47970.1 repressor protein TetR Not tested AbaR25 Protein 9e-41 49
tetR AFV47998.1 repressor protein TetR Not tested delta-AbaR25 Protein 9e-41 49

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
tetR YP_001715370.1 tetracycline repressor protein class G VFG1035 Protein 1e-39 50