Gene Information

Name : Daud_1419 (Daud_1419)
Accession : YP_001717558.1
Strain : Candidatus Desulforudis audaxviator MP104C
Genome accession: NC_010424
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1502747 - 1503442 bp
Length : 696 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: chy:CHY_2047 DNA-binding response regulator

DNA sequence :
ATGGCAAGGATTCTGGTGGTTGAGGACGAAAAACACATTGTCGAGCTGATGCGGTACGGCCTCGAGAAAGAGGGCTTTCA
AGTAGTGGAGGCCAACGACGGCGACCGGGCGTTGGAAATGGTCCACACCGGGCGGATCGACCTGGTGGTCCTGGACATTA
TGCTGCCCGGGCTGGACGGCCTGACCGTCTGCCGCCTGTTGCGCCAGAACGAGCGCACCCGGGATATCCCGGTAATCATC
CTCAGCGCCCGGGGTCAGGAGCTGGACCGCGTGCTCGGCCTGGAACTGGGCGCGGACGACTATATTACCAAGCCGTTCAG
CGTCCGGGAATTGGTCGCGCGGGTCAAAGCGCGGCTGCGCCGTCACGTCCCGGTACAGGAGGCGCGGAAGACGGCCCGGT
TCGGCGACCTGGTGGTCGATCCGGAGCGCCTGGCGGTGGAGGCGGCGGGAAAGCGGGAGCAACTGACGCCCACCGAATTC
GAGTTATTGTGGGTATTGGCCGGGAGCCCCGGCCGGGTTTTCTCCCGCGAATTGCTGCTCCAGAAGGTCTGGGGCTATGA
TTATACGGGGGATTCCCGCACTGTAGACGTGCATATCCGTCACGTGCGGCAAAAGCTGCAGCGGCTGCCCGGAAGCCCCC
AGTACATTGAAACGGTGCGCGGAGTCGGCTACCGTTTCCGGGAGTTGAGCGAATGA

Protein sequence :
MARILVVEDEKHIVELMRYGLEKEGFQVVEANDGDRALEMVHTGRIDLVVLDIMLPGLDGLTVCRLLRQNERTRDIPVII
LSARGQELDRVLGLELGADDYITKPFSVRELVARVKARLRRHVPVQEARKTARFGDLVVDPERLAVEAAGKREQLTPTEF
ELLWVLAGSPGRVFSRELLLQKVWGYDYTGDSRTVDVHIRHVRQKLQRLPGSPQYIETVRGVGYRFRELSE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-41 46
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 3e-41 45
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 6e-35 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 9e-35 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Daud_1419 YP_001717558.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 1e-50 51
Daud_1419 YP_001717558.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 1e-50 51
Daud_1419 YP_001717558.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 1e-50 51
Daud_1419 YP_001717558.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 8e-51 51
Daud_1419 YP_001717558.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 1e-50 51
Daud_1419 YP_001717558.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 1e-50 51
Daud_1419 YP_001717558.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 1e-50 51
Daud_1419 YP_001717558.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 1e-50 51
Daud_1419 YP_001717558.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 1e-50 51
Daud_1419 YP_001717558.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 1e-50 51
Daud_1419 YP_001717558.1 two component transcriptional regulator NC_012469.1.7686381. Protein 9e-50 48
Daud_1419 YP_001717558.1 two component transcriptional regulator NC_012469.1.7685629. Protein 4e-49 47
Daud_1419 YP_001717558.1 two component transcriptional regulator HE999704.1.gene2815. Protein 3e-50 47
Daud_1419 YP_001717558.1 two component transcriptional regulator AE000516.2.gene3505. Protein 2e-39 46
Daud_1419 YP_001717558.1 two component transcriptional regulator BAC0596 Protein 2e-39 46
Daud_1419 YP_001717558.1 two component transcriptional regulator CP001138.1.gene2239. Protein 2e-39 46
Daud_1419 YP_001717558.1 two component transcriptional regulator CP001918.1.gene3444. Protein 9e-38 45
Daud_1419 YP_001717558.1 two component transcriptional regulator CP000034.1.gene2186. Protein 3e-39 45
Daud_1419 YP_001717558.1 two component transcriptional regulator NC_002695.1.916589.p Protein 3e-39 45
Daud_1419 YP_001717558.1 two component transcriptional regulator CP000647.1.gene2531. Protein 6e-39 45
Daud_1419 YP_001717558.1 two component transcriptional regulator BAC0039 Protein 3e-39 45
Daud_1419 YP_001717558.1 two component transcriptional regulator AE016830.1.gene1681. Protein 2e-48 44
Daud_1419 YP_001717558.1 two component transcriptional regulator CP004022.1.gene3215. Protein 9e-34 44
Daud_1419 YP_001717558.1 two component transcriptional regulator FJ349556.1.orf0.gene Protein 3e-42 44
Daud_1419 YP_001717558.1 two component transcriptional regulator CP001138.1.gene4273. Protein 6e-31 43
Daud_1419 YP_001717558.1 two component transcriptional regulator NC_002695.1.915041.p Protein 2e-31 43
Daud_1419 YP_001717558.1 two component transcriptional regulator CP000034.1.gene3834. Protein 2e-31 43
Daud_1419 YP_001717558.1 two component transcriptional regulator CP001918.1.gene5135. Protein 1e-25 43
Daud_1419 YP_001717558.1 two component transcriptional regulator AF155139.2.orf0.gene Protein 6e-45 43
Daud_1419 YP_001717558.1 two component transcriptional regulator BAC0197 Protein 3e-31 43
Daud_1419 YP_001717558.1 two component transcriptional regulator BAC0533 Protein 7e-31 42
Daud_1419 YP_001717558.1 two component transcriptional regulator CP000647.1.gene4257. Protein 7e-31 42
Daud_1419 YP_001717558.1 two component transcriptional regulator AF162694.1.orf4.gene Protein 8e-35 42
Daud_1419 YP_001717558.1 two component transcriptional regulator HE999704.1.gene1528. Protein 2e-35 41
Daud_1419 YP_001717558.1 two component transcriptional regulator NC_014475.1.orf0.gen Protein 2e-40 41
Daud_1419 YP_001717558.1 two component transcriptional regulator NC_005054.2598277.p0 Protein 2e-40 41
Daud_1419 YP_001717558.1 two component transcriptional regulator BAC0308 Protein 4e-31 41
Daud_1419 YP_001717558.1 two component transcriptional regulator BAC0125 Protein 1e-30 41
Daud_1419 YP_001717558.1 two component transcriptional regulator CP004022.1.gene1676. Protein 4e-35 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Daud_1419 YP_001717558.1 two component transcriptional regulator VFG1702 Protein 4e-42 46
Daud_1419 YP_001717558.1 two component transcriptional regulator VFG1389 Protein 2e-32 46
Daud_1419 YP_001717558.1 two component transcriptional regulator VFG1390 Protein 2e-41 45
Daud_1419 YP_001717558.1 two component transcriptional regulator VFG1563 Protein 2e-41 45
Daud_1419 YP_001717558.1 two component transcriptional regulator VFG0596 Protein 2e-35 43
Daud_1419 YP_001717558.1 two component transcriptional regulator VFG1386 Protein 6e-37 42