Gene Information

Name : YPK_3131 (YPK_3131)
Accession : YP_001721855.1
Strain : Yersinia pseudotuberculosis YPIII
Genome accession: NC_010465
Putative virulence/resistance : Virulence
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3425308 - 3425691 bp
Length : 384 bp
Strand : -
Note : PFAM: protein of unknown function DUF1219; KEGG: yps:YPTB3866 hypothetical protein

DNA sequence :
ATGCAAACCTTACCCGTAAACCCGAAACGGGCGGCACAAACCTGCCCGTCACCTGTTGAAATATGGCAAAAACTGCTAAC
GCATCTGCTCGATCAACACTATGGACTCACACTTAGTGATACCTCGTTCAGCAATGAAACCACCATCCGTGAACATATTG
ACGCCGGAATATCCCTCAGCTATGCGGTGAACTTCCTGGTGGAAAAATATGAACTGGTACGCACTGACCGGACCAGTTTC
ACCATTGTGGAGCAATCACCGTTTATCACCCCAATCGATATTCTCCGCGCCAGGCAAGCCACCGGTCTCCTGAAGCGCAG
TGGTTATAAAGCCGTCAGTGACATTACCCGTGGCAGAGCTCGGCGAGAGGAGCAAAGCCATTGA

Protein sequence :
MQTLPVNPKRAAQTCPSPVEIWQKLLTHLLDQHYGLTLSDTSFSNETTIREHIDAGISLSYAVNFLVEKYELVRTDRTSF
TIVEQSPFITPIDILRARQATGLLKRSGYKAVSDITRGRARREEQSH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
ECO103_3592 YP_003223449.1 hypothetical protein Not tested LEE Protein 7e-34 64
unnamed AAL67342.1 intergenic-region protein Not tested PAI II CFT073 Protein 1e-34 64
unnamed CAD66207.1 hypothetical protein Not tested PAI III 536 Protein 4e-34 63
yeeV YP_854325.1 hypothetical protein Not tested PAI I APEC-O1 Protein 2e-34 62
unnamed AAK00482.1 unknown Not tested SHI-1 Protein 4e-35 62
yeeV NP_838487.1 hypothetical protein Not tested SHI-1 Protein 6e-35 62
yeeV NP_708773.1 hypothetical protein Not tested SHI-1 Protein 6e-35 62
yeeV AAZ04461.1 conserved hypothetical protein Not tested PAI I APEC-O1 Protein 1e-33 62
z5091 CAD33789.1 Z5091 protein Not tested PAI I 536 Protein 2e-33 61
unnamed AAL57575.1 unknown Not tested LEE Protein 4e-33 61
unnamed AAL67389.1 L0007-like protein Not tested PAI II CFT073 Protein 8e-34 61
c5149 NP_756997.1 hypothetical protein Not tested PAI II CFT073 Protein 1e-33 61
unnamed CAD42101.1 hypothetical protein Not tested PAI II 536 Protein 3e-33 61
yeeV CAE85204.1 YeeV protein Not tested PAI V 536 Protein 2e-34 60
aec76 AAW51759.1 Aec76 Not tested AGI-3 Protein 1e-33 60
Z5091 NP_290242.1 hypothetical protein Not tested LEE Protein 5e-33 60
unnamed AAC31486.1 L0007 Not tested LEE Protein 4e-33 60
ECs4539 NP_312566.1 hypothetical protein Not tested LEE Protein 5e-33 60
unnamed ACU09433.1 conserved hypothetical protein Not tested LEE Protein 4e-33 60
unnamed CAI43848.1 hypothetical protein Not tested LEE Protein 1e-33 60
yeeV ADD91699.1 YeeV Not tested PAI-I AL862 Protein 2e-33 60
unnamed AAL08478.1 unknown Not tested SRL Protein 3e-32 59

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
YPK_3131 YP_001721855.1 hypothetical protein VFG1682 Protein 2e-34 63
YPK_3131 YP_001721855.1 hypothetical protein VFG0663 Protein 2e-35 62
YPK_3131 YP_001721855.1 hypothetical protein VFG1530 Protein 6e-34 61
YPK_3131 YP_001721855.1 hypothetical protein VFG1620 Protein 1e-33 61
YPK_3131 YP_001721855.1 hypothetical protein VFG0786 Protein 2e-33 60
YPK_3131 YP_001721855.1 hypothetical protein VFG1069 Protein 1e-32 59