Gene Information

Name : EcolC_3446 (EcolC_3446)
Accession : YP_001726388.1
Strain : Escherichia coli ATCC 8739
Genome accession: NC_010468
Putative virulence/resistance : Virulence
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3760562 - 3760939 bp
Length : 378 bp
Strand : +
Note : PFAM: protein of unknown function DUF1219; KEGG: sdy:SDY_1009 hypothetical protein

DNA sequence :
ATGCAAACCCAACCACTATCCTCAACGCAGGAGGCTACATCACGCCCGTCACCGGTGGAGATCTGGCAACGGCTTCTGAG
CCACCTGTTGGATCGTCACTACGGTCTGACGCTTAACGACACGCCGTTTGGCAACGACGGTGTGATTCAGGAGCATATCG
ACGCCGGTATATCACTGTGCGACGCCGTGAATTTTATTGTGGAGAAGTACGATCTGGTGCGCATCGATCGTCACGGTTTC
AGTACAGAAACACAGTTGCCGCGTCTCACCAGTATCGATATTCTCCGCGCCCGCAAAGCCACCGGGTTGATGACTCGCAA
CGATTACAGAACGGTGACCGACATCACCACCGGTAAATACCGTGGGGGGCATCGATGA

Protein sequence :
MQTQPLSSTQEATSRPSPVEIWQRLLSHLLDRHYGLTLNDTPFGNDGVIQEHIDAGISLCDAVNFIVEKYDLVRIDRHGF
STETQLPRLTSIDILRARKATGLMTRNDYRTVTDITTGKYRGGHR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAI43848.1 hypothetical protein Not tested LEE Protein 9e-35 67
aec76 AAW51759.1 Aec76 Not tested AGI-3 Protein 9e-35 67
ECO103_3592 YP_003223449.1 hypothetical protein Not tested LEE Protein 5e-35 66
z5091 CAD33789.1 Z5091 protein Not tested PAI I 536 Protein 8e-36 65
yeeV AAZ04461.1 conserved hypothetical protein Not tested PAI I APEC-O1 Protein 1e-34 65
yeeV ADD91699.1 YeeV Not tested PAI-I AL862 Protein 3e-36 64
unnamed AAL67389.1 L0007-like protein Not tested PAI II CFT073 Protein 1e-34 64
c5149 NP_756997.1 hypothetical protein Not tested PAI II CFT073 Protein 2e-34 64
unnamed CAD66207.1 hypothetical protein Not tested PAI III 536 Protein 3e-34 63
Z5091 NP_290242.1 hypothetical protein Not tested LEE Protein 3e-34 63
unnamed AAL08478.1 unknown Not tested SRL Protein 2e-34 63
ECs4539 NP_312566.1 hypothetical protein Not tested LEE Protein 3e-34 63
unnamed AAC31486.1 L0007 Not tested LEE Protein 2e-34 63
unnamed ACU09433.1 conserved hypothetical protein Not tested LEE Protein 2e-34 63
unnamed CAD42101.1 hypothetical protein Not tested PAI II 536 Protein 1e-34 62
unnamed AAL57575.1 unknown Not tested LEE Protein 6e-34 62
yeeV CAE85204.1 YeeV protein Not tested PAI V 536 Protein 4e-35 62
unnamed AAL67342.1 intergenic-region protein Not tested PAI II CFT073 Protein 1e-34 62
yeeV YP_854325.1 hypothetical protein Not tested PAI I APEC-O1 Protein 3e-35 62
yeeV NP_838487.1 hypothetical protein Not tested SHI-1 Protein 2e-35 61
yeeV NP_708773.1 hypothetical protein Not tested SHI-1 Protein 2e-35 61
unnamed AAK00482.1 unknown Not tested SHI-1 Protein 2e-35 61

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
EcolC_3446 YP_001726388.1 hypothetical protein VFG1530 Protein 3e-36 65
EcolC_3446 YP_001726388.1 hypothetical protein VFG1682 Protein 1e-34 63
EcolC_3446 YP_001726388.1 hypothetical protein VFG0786 Protein 8e-35 63
EcolC_3446 YP_001726388.1 hypothetical protein VFG1069 Protein 9e-35 63
EcolC_3446 YP_001726388.1 hypothetical protein VFG1620 Protein 4e-35 62
EcolC_3446 YP_001726388.1 hypothetical protein VFG0663 Protein 7e-36 61