Gene Information

Name : ykfI (ECDH10B_0227)
Accession : YP_001729189.1
Strain : Escherichia coli K-12
Genome accession: NC_010473
Putative virulence/resistance : Virulence
Product : CP4-6 prophage; toxin of the YkfI-YafW toxin-antitoxin system
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 236656 - 236997 bp
Length : 342 bp
Strand : -
Note : -

DNA sequence :
ATGAAAACTTTACCTGCAATAACTCAGCGGGCGGTGAAGCCCTGCCTGTCACCCGTGGCTGTCTGGCAAATGTTACTGAC
ACGTCTGCTGGAACAGCACTATGGTCTGACAATAAACGACACGCCATTCTGCAATGAGGCTGTGATTAAGGAACACATCG
ATGCCGGTATCACCCTAGCCGATGCCGTGAATTTTCTGGTAGAAAAATACGAGCTGGTTCGTATCGACAGGAAGGGATTT
AGCTGGCAGGAACAATCTCCTTATCTCCGGGCTGCAGACATTCTGCGAGCGCGGCAGGCAACTGGCTTGTTGCGGCAAAG
CCGTAACAACGTAGTACGATGA

Protein sequence :
MKTLPAITQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD66207.1 hypothetical protein Not tested PAI III 536 Protein 1e-28 65
unnamed AAL57575.1 unknown Not tested LEE Protein 3e-28 64
unnamed CAI43848.1 hypothetical protein Not tested LEE Protein 1e-27 63
aec76 AAW51759.1 Aec76 Not tested AGI-3 Protein 1e-27 63
unnamed AAL08478.1 unknown Not tested SRL Protein 4e-27 63
unnamed CAD42101.1 hypothetical protein Not tested PAI II 536 Protein 1e-27 63
Z5091 NP_290242.1 hypothetical protein Not tested LEE Protein 5e-27 62
ECs4539 NP_312566.1 hypothetical protein Not tested LEE Protein 5e-27 62
unnamed AAC31486.1 L0007 Not tested LEE Protein 4e-27 62
unnamed ACU09433.1 conserved hypothetical protein Not tested LEE Protein 4e-27 62
yeeV ADD91699.1 YeeV Not tested PAI-I AL862 Protein 5e-27 62
c5149 NP_756997.1 hypothetical protein Not tested PAI II CFT073 Protein 6e-27 62
unnamed AAL67389.1 L0007-like protein Not tested PAI II CFT073 Protein 4e-27 62
unnamed AAK00482.1 unknown Not tested SHI-1 Protein 3e-28 62
yeeV NP_838487.1 hypothetical protein Not tested SHI-1 Protein 4e-28 62
yeeV NP_708773.1 hypothetical protein Not tested SHI-1 Protein 4e-28 62
ECO103_3592 YP_003223449.1 hypothetical protein Not tested LEE Protein 1e-28 61
unnamed AAL67342.1 intergenic-region protein Not tested PAI II CFT073 Protein 1e-27 60
z5091 CAD33789.1 Z5091 protein Not tested PAI I 536 Protein 1e-26 59
yeeV CAE85204.1 YeeV protein Not tested PAI V 536 Protein 1e-27 59
yeeV YP_854325.1 hypothetical protein Not tested PAI I APEC-O1 Protein 2e-28 59

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ykfI YP_001729189.1 CP4-6 prophage; toxin of the YkfI-YafW toxin-antitoxin system VFG1682 Protein 6e-29 65
ykfI YP_001729189.1 CP4-6 prophage; toxin of the YkfI-YafW toxin-antitoxin system VFG1069 Protein 2e-27 63
ykfI YP_001729189.1 CP4-6 prophage; toxin of the YkfI-YafW toxin-antitoxin system VFG1620 Protein 5e-28 63
ykfI YP_001729189.1 CP4-6 prophage; toxin of the YkfI-YafW toxin-antitoxin system VFG0786 Protein 2e-27 62
ykfI YP_001729189.1 CP4-6 prophage; toxin of the YkfI-YafW toxin-antitoxin system VFG0663 Protein 1e-28 62
ykfI YP_001729189.1 CP4-6 prophage; toxin of the YkfI-YafW toxin-antitoxin system VFG1530 Protein 6e-27 59