Gene Information

Name : SYNPCC7002_G0158 (SYNPCC7002_G0158)
Accession : YP_001733267.1
Strain :
Genome accession: NC_010474
Putative virulence/resistance : Virulence
Product : two-component response regulator; transcriptional regulatory protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 180125 - 180796 bp
Length : 672 bp
Strand : -
Note : similar to syc2221_c of Synechococcus elongatus PCC 6301

DNA sequence :
ATGAAACCCCATATTTTACTGGCCGAAGATGACCAAAACCTCGCTCAATTCGTTGCCTCCGAATTACGCCTAGAAGGTTA
TTTGATCACCGTTGCCCACAACGGCATCGATAGTCTAAATTTAATCCGAGAAAATACCTATGACCTATTGATTTTCGATT
GGCTCATGCCGGGCTTGTCGGGGCTAGATCTCTGCTTGCGACTCCGCTCTAGTGGCATCGAAACGCCGATTCTTCTGTTG
ACCGCAAAAGATGAAATTTCTGATCGGGTCTCTGGGTTAAATGCCGGGGCCGATGATTATGTCACAAAGCCCTTTAGCAT
TGAAGAACTACTGGCCCGTGTCAATGCCCATCTCCGCCGCGCTCGCCGGGAAGTGGTTGACCAATTAGAATTCGAGGATC
TTTCTCTCAATGGCATTACCCGCGAAGTTTACCGCGATCGCCAACTGATCCAGCTCACCGCCAAGGAATTTGATTTGTTA
GAGTTACTCCTGCGCCACCCACGGCAAGTCTTAACCCGCGAGCAGATCCTCGAAAAAGTTTGGGGCTATGACTTTATGGG
AGAATCCAACGTGATCGAAGTCTACATTCGGGCTTTACGACTGAAGCTCGAAGCAACCAATCCGAAGCGATTGATCCATA
CGGTACGCAGTGTGGGCTATGTCTTAAAATAA

Protein sequence :
MKPHILLAEDDQNLAQFVASELRLEGYLITVAHNGIDSLNLIRENTYDLLIFDWLMPGLSGLDLCLRLRSSGIETPILLL
TAKDEISDRVSGLNAGADDYVTKPFSIEELLARVNAHLRRARREVVDQLEFEDLSLNGITREVYRDRQLIQLTAKEFDLL
ELLLRHPRQVLTREQILEKVWGYDFMGESNVIEVYIRALRLKLEATNPKRLIHTVRSVGYVLK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 6e-35 41
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-35 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SYNPCC7002_G0158 YP_001733267.1 two-component response regulator; transcriptional regulatory protein NC_003923.1003417.p0 Protein 9e-42 44
SYNPCC7002_G0158 YP_001733267.1 two-component response regulator; transcriptional regulatory protein NC_013450.8614146.p0 Protein 9e-42 44
SYNPCC7002_G0158 YP_001733267.1 two-component response regulator; transcriptional regulatory protein NC_002951.3238224.p0 Protein 9e-42 44
SYNPCC7002_G0158 YP_001733267.1 two-component response regulator; transcriptional regulatory protein NC_007793.3914065.p0 Protein 9e-42 44
SYNPCC7002_G0158 YP_001733267.1 two-component response regulator; transcriptional regulatory protein NC_002758.1121390.p0 Protein 9e-42 44
SYNPCC7002_G0158 YP_001733267.1 two-component response regulator; transcriptional regulatory protein NC_010079.5776364.p0 Protein 9e-42 44
SYNPCC7002_G0158 YP_001733267.1 two-component response regulator; transcriptional regulatory protein NC_002952.2859858.p0 Protein 9e-42 44
SYNPCC7002_G0158 YP_001733267.1 two-component response regulator; transcriptional regulatory protein NC_007622.3794948.p0 Protein 9e-42 44
SYNPCC7002_G0158 YP_001733267.1 two-component response regulator; transcriptional regulatory protein BAC0308 Protein 4e-39 44
SYNPCC7002_G0158 YP_001733267.1 two-component response regulator; transcriptional regulatory protein AE015929.1.gene1106. Protein 2e-37 43
SYNPCC7002_G0158 YP_001733267.1 two-component response regulator; transcriptional regulatory protein BAC0083 Protein 1e-40 43
SYNPCC7002_G0158 YP_001733267.1 two-component response regulator; transcriptional regulatory protein HE999704.1.gene1528. Protein 1e-37 42
SYNPCC7002_G0158 YP_001733267.1 two-component response regulator; transcriptional regulatory protein BAC0125 Protein 5e-42 42
SYNPCC7002_G0158 YP_001733267.1 two-component response regulator; transcriptional regulatory protein AF155139.2.orf0.gene Protein 4e-34 42
SYNPCC7002_G0158 YP_001733267.1 two-component response regulator; transcriptional regulatory protein BAC0638 Protein 6e-32 42
SYNPCC7002_G0158 YP_001733267.1 two-component response regulator; transcriptional regulatory protein AE000516.2.gene3505. Protein 1e-34 42
SYNPCC7002_G0158 YP_001733267.1 two-component response regulator; transcriptional regulatory protein BAC0347 Protein 1e-36 41
SYNPCC7002_G0158 YP_001733267.1 two-component response regulator; transcriptional regulatory protein NC_002516.2.879194.p Protein 3e-26 41
SYNPCC7002_G0158 YP_001733267.1 two-component response regulator; transcriptional regulatory protein BAC0111 Protein 4e-39 41
SYNPCC7002_G0158 YP_001733267.1 two-component response regulator; transcriptional regulatory protein BAC0197 Protein 9e-37 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SYNPCC7002_G0158 YP_001733267.1 two-component response regulator; transcriptional regulatory protein VFG1390 Protein 2e-52 49
SYNPCC7002_G0158 YP_001733267.1 two-component response regulator; transcriptional regulatory protein VFG1389 Protein 6e-36 42
SYNPCC7002_G0158 YP_001733267.1 two-component response regulator; transcriptional regulatory protein VFG0596 Protein 2e-35 41
SYNPCC7002_G0158 YP_001733267.1 two-component response regulator; transcriptional regulatory protein VFG1386 Protein 2e-41 41