Name : EcSMS35_3196 (EcSMS35_3196) Accession : YP_001745179.1 Strain : Escherichia coli SMS-3-5 Genome accession: NC_010498 Putative virulence/resistance : Virulence Product : AlpA family transcriptional regulator Function : - COG functional category : K : Transcription COG ID : COG3311 EC number : - Position : 3275772 - 3276008 bp Length : 237 bp Strand : - Note : identified by match to protein family HMM PF05930 DNA sequence : ATGTTGACCTCAATGACAGGTCACGACAGCGTATTGCTGCGTGCCGACGATCCCCTGATCGACATGAACTACATCACCAG CTTCACTGGTATGACCGACAAATGGTTTTACAAGCTGATCAGTGAAGGCCATTTCCCTAAACCCATCAAACTGGGGCGCA GCAGCCGCTGGTACAAAAGTGAAGTGGAGCAGTGGATGCAGCAACGAATCGAGGCATCACGAGGGGCAGCAGCATGA Protein sequence : MLTSMTGHDSVLLRADDPLIDMNYITSFTGMTDKWFYKLISEGHFPKPIKLGRSSRWYKSEVEQWMQQRIEASRGAAA |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
unnamed | CAD33739.1 | hypothetical protein | Not tested | PAI I 536 | Protein | 5e-30 | 95 |
c5192 | NP_757040.1 | hypothetical protein | Not tested | PAI II CFT073 | Protein | 8e-30 | 95 |
Z1188 | NP_286723.1 | hypothetical protein | Not tested | TAI | Protein | 1e-23 | 91 |
Z1627 | NP_287131.1 | hypothetical protein | Not tested | TAI | Protein | 1e-23 | 91 |
S3190 | NP_838473.1 | hypothetical protein | Not tested | SHI-1 | Protein | 3e-17 | 70 |
SF2987 | NP_708761.1 | hypothetical protein | Not tested | SHI-1 | Protein | 3e-17 | 70 |
ECO103_3577 | YP_003223438.1 | transcriptional regulator | Not tested | LEE | Protein | 2e-17 | 70 |
rox | AAR97599.1 | regulator of excision | Not tested | SHI-1 | Protein | 2e-17 | 70 |
unnamed | CAE85187.1 | hypothetical protein | Not tested | PAI V 536 | Protein | 1e-17 | 70 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
EcSMS35_3196 | YP_001745179.1 | AlpA family transcriptional regulator | VFG1480 | Protein | 2e-30 | 95 |
EcSMS35_3196 | YP_001745179.1 | AlpA family transcriptional regulator | VFG0651 | Protein | 1e-17 | 70 |