Gene Information

Name : PputW619_2337 (PputW619_2337)
Accession : YP_001749206.1
Strain : Pseudomonas putida W619
Genome accession: NC_010501
Putative virulence/resistance : Resistance
Product : transcriptional regulator MerD
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 2610786 - 2611151 bp
Length : 366 bp
Strand : -
Note : TIGRFAM: mercuric resistence transcriptional repressor protein MerD; PFAM: regulatory protein MerR; KEGG: pap:PSPA7_0105 mercuric resistence transcriptional repressor protein MerD

DNA sequence :
ATGAACGCCTACACGGTGTCCCGGCTGGCTCTTGATGCCGGGGTGAGCGTGCATATCGTGCGCGACTACCTGCTGCGCGG
ATTGCTGCGCCCGGTGGCGTGCACACCAGGCGGCTACGGCTTGTTCGATGACGCCGCCTTGCAACGGCTGTGCTTCGTGC
GGGCGGCCTTCGAGGCGGGCATCGGCCTCGACGCGCTGGCGCGGCTGTGCCGGGCGCTGGATGCGGCGGACGGCGACGAA
GCGGCCGCGCAGCTTGCCCTGCTGCGTCAGTTCGTCGAGCGTCGGCGCGAAGCGTTGGCCGATCTGGAAGTGCAGTTGGC
CACCCTGCCGACCGAGCCGGCACAGCACGCGGAGAGTCTGCCATGA

Protein sequence :
MNAYTVSRLALDAGVSVHIVRDYLLRGLLRPVACTPGGYGLFDDAALQRLCFVRAAFEAGIGLDALARLCRALDAADGDE
AAAQLALLRQFVERRREALADLEVQLATLPTEPAQHAESLP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merD AGK07020.1 MerD Not tested SGI1 Protein 8e-35 100
merD AGK07078.1 MerD Not tested SGI1 Protein 8e-35 100
merD ABQ57370.1 MerD Not tested SGI1 Protein 2e-34 99
merD ACN81004.1 MerD Not tested AbaR5 Protein 9e-31 90
merD CAJ77059.1 Mercury operon coregulator protein Not tested AbaR1 Protein 1e-30 90
merD ACF06181.1 mercuric resistance protein Not tested Tn5036-like Protein 3e-27 82
merD AET25396.1 MerD Not tested PAGI-2(C) Protein 3e-27 82
merD AFG30119.1 MerD Not tested PAGI-2 Protein 3e-27 82
merD YP_006098386.1 MerR family transcriptional regulator Not tested Tn2411 Protein 4e-27 82

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PputW619_2337 YP_001749206.1 transcriptional regulator MerD BAC0668 Protein 4e-35 100
PputW619_2337 YP_001749206.1 transcriptional regulator MerD BAC0666 Protein 5e-35 99
PputW619_2337 YP_001749206.1 transcriptional regulator MerD BAC0227 Protein 9e-35 99
PputW619_2337 YP_001749206.1 transcriptional regulator MerD BAC0665 Protein 2e-35 97
PputW619_2337 YP_001749206.1 transcriptional regulator MerD BAC0667 Protein 1e-34 92
PputW619_2337 YP_001749206.1 transcriptional regulator MerD BAC0669 Protein 2e-33 86