Gene Information

Name : pRALTA_0481 (pRALTA_0481)
Accession : YP_001796307.1
Strain :
Genome accession: NC_010529
Putative virulence/resistance : Unknown
Product : transposase, IS66 family
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 411669 - 412016 bp
Length : 348 bp
Strand : +
Note : Evidence 2b : Function of strongly homologous gene; Product type h : extrachromosomal origin

DNA sequence :
ATGATCGGGTTGCCGGCGGGAACACGCATCTGGATCGCTGCAGGCGTGACCGACATGCGCTGTGGATTCAACGGGCTCGC
CGCGAAGGTGGAGGCGACTCTGCAAGAGAGCCCATTCTCCGGCCATGTCTTCGTCTTCCGCGGCAGGCGCGGCAACGTCA
TCAAGGTGTTGTGGTCAACGGGCGATGGACTTTGCTTGCTCTCGAAGCGCCTGGAGCGTGGACGTTTCGTCTGGCCGAAG
GCCGACAGCGGCAAGATCCACCTGACGCAAGCGCAGTTGTCGATGCTGCTGGAGGGGATTAACTGGAAGCAGCCCGAGCG
CACCTGGCCGCCACAGTCGGTGTTGTAA

Protein sequence :
MIGLPAGTRIWIAAGVTDMRCGFNGLAAKVEATLQESPFSGHVFVFRGRRGNVIKVLWSTGDGLCLLSKRLERGRFVWPK
ADSGKIHLTQAQLSMLLEGINWKQPERTWPPQSVL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 2e-38 73
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 2e-38 73
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 5e-38 72
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 2e-38 72
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 2e-38 72
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 4e-28 70
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 2e-36 67
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 2e-36 67
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 9e-37 67
unnamed AAC31493.1 L0014 Not tested LEE Protein 6e-37 67
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 6e-37 67
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 9e-37 67
unnamed AAL99258.1 unknown Not tested LEE Protein 6e-37 67
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 9e-37 67
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 1e-34 67
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 6e-37 67
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 9e-37 67
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 4e-36 67
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 4e-36 67
unnamed AAL08461.1 unknown Not tested SRL Protein 1e-36 66
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 2e-33 58
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 2e-33 58
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 2e-33 57
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 6e-32 56
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 6e-32 56

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
pRALTA_0481 YP_001796307.1 transposase, IS66 family VFG1665 Protein 2e-38 72
pRALTA_0481 YP_001796307.1 transposase, IS66 family VFG1517 Protein 2e-28 70
pRALTA_0481 YP_001796307.1 transposase, IS66 family VFG1698 Protein 4e-37 67
pRALTA_0481 YP_001796307.1 transposase, IS66 family VFG1709 Protein 2e-37 67
pRALTA_0481 YP_001796307.1 transposase, IS66 family VFG0792 Protein 2e-37 67
pRALTA_0481 YP_001796307.1 transposase, IS66 family VFG1052 Protein 5e-37 66
pRALTA_0481 YP_001796307.1 transposase, IS66 family VFG1737 Protein 6e-34 57