Gene Information

Name : copR (RALTA_B1969)
Accession : YP_002008600.1
Strain :
Genome accession: NC_010530
Putative virulence/resistance : Virulence
Product : response regulator in two-component regulatory system with cops, regulation of copper resistance
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2136329 - 2137054 bp
Length : 726 bp
Strand : +
Note : Evidence 2a : Function of homologous gene experimentally demonstrated in an other organism; PubMedId : 8449873; Product type r : regulator

DNA sequence :
ATGAAACTGCTTGTGGTGGAGGACGAATCCAAGACCGGCGAATACCTGCGCCAGGGGCTGACCGAGGCGGGCTTCGTCGT
CGACCTGGTGCACAACGGGCTGGACGGCCAGCATATGGCCATGACCGAGCCCTACGACCTGATCATCCTGGACGTGATGC
TGCCGGATGTGGATGGCTGGCGCATCGTGCAGGCCCTGCGCGCAGGGCAAAACCCCGTGCCGGTGCTGTTCCTGACCGCG
CGCGACAGCGTGGCCGACCGCGTCAAGGGGCTGGAGCTGGGCGCGGACGACTACCTGGTCAAGCCGTTCGCCTTCTCCGA
ACTGCTCGCGCGCGTGCGCACGCTGCTGCGCCGCGGCACCGCGCAGATGACGCTGGACCGCATCCAGGTGGCCGACCTGG
TGCTGGACCTGACCCGCCGCCGCGCCACGCGTGCCGGCCGCCGCATCACGCTGACCAGCAAGGAGTTCGCGCTGCTGGAA
CTGCTGGCGCGCCGCCGCGGCGAGGTGCTGCCGCGCTCGCTGATCGCCTCACAGGTGTGGGACATGAATTTCGACAGCGA
CAGCAATGTCATCGACGTCGCCATCCGGCGCCTGCGCGCCAAGATCGACGACGGCTTCGATGCCAGGCTGATCCAGACCG
TGCGCGGCATGGGCTATGTGCTCGAAGCGCCCGAAGCCGCCGACGAAGCAGGCGCGCCTCTGGCAAACGACGGGCAACCC
ACATGA

Protein sequence :
MKLLVVEDESKTGEYLRQGLTEAGFVVDLVHNGLDGQHMAMTEPYDLIILDVMLPDVDGWRIVQALRAGQNPVPVLFLTA
RDSVADRVKGLELGADDYLVKPFAFSELLARVRTLLRRGTAQMTLDRIQVADLVLDLTRRRATRAGRRITLTSKEFALLE
LLARRRGEVLPRSLIASQVWDMNFDSDSNVIDVAIRRLRAKIDDGFDARLIQTVRGMGYVLEAPEAADEAGAPLANDGQP
T

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 9e-47 59
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 5e-46 58

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
copR YP_002008600.1 response regulator in two-component regulatory system with cops, regulation of copper resistance BAC0111 Protein 5e-58 71
copR YP_002008600.1 response regulator in two-component regulatory system with cops, regulation of copper resistance BAC0083 Protein 3e-54 70
copR YP_002008600.1 response regulator in two-component regulatory system with cops, regulation of copper resistance BAC0638 Protein 5e-55 70
copR YP_002008600.1 response regulator in two-component regulatory system with cops, regulation of copper resistance BAC0197 Protein 4e-51 67
copR YP_002008600.1 response regulator in two-component regulatory system with cops, regulation of copper resistance BAC0347 Protein 3e-49 64
copR YP_002008600.1 response regulator in two-component regulatory system with cops, regulation of copper resistance BAC0308 Protein 2e-49 64
copR YP_002008600.1 response regulator in two-component regulatory system with cops, regulation of copper resistance BAC0125 Protein 5e-49 63
copR YP_002008600.1 response regulator in two-component regulatory system with cops, regulation of copper resistance NC_013450.8614146.p0 Protein 1e-26 42
copR YP_002008600.1 response regulator in two-component regulatory system with cops, regulation of copper resistance NC_002951.3238224.p0 Protein 1e-26 42
copR YP_002008600.1 response regulator in two-component regulatory system with cops, regulation of copper resistance NC_007793.3914065.p0 Protein 1e-26 42
copR YP_002008600.1 response regulator in two-component regulatory system with cops, regulation of copper resistance NC_002758.1121390.p0 Protein 1e-26 42
copR YP_002008600.1 response regulator in two-component regulatory system with cops, regulation of copper resistance NC_010079.5776364.p0 Protein 1e-26 42
copR YP_002008600.1 response regulator in two-component regulatory system with cops, regulation of copper resistance NC_002952.2859858.p0 Protein 1e-26 42
copR YP_002008600.1 response regulator in two-component regulatory system with cops, regulation of copper resistance NC_007622.3794948.p0 Protein 1e-26 42
copR YP_002008600.1 response regulator in two-component regulatory system with cops, regulation of copper resistance NC_003923.1003417.p0 Protein 1e-26 42
copR YP_002008600.1 response regulator in two-component regulatory system with cops, regulation of copper resistance BAC0487 Protein 2e-20 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
copR YP_002008600.1 response regulator in two-component regulatory system with cops, regulation of copper resistance VFG0596 Protein 4e-47 59
copR YP_002008600.1 response regulator in two-component regulatory system with cops, regulation of copper resistance VFG1389 Protein 2e-23 47
copR YP_002008600.1 response regulator in two-component regulatory system with cops, regulation of copper resistance VFG1390 Protein 1e-30 45
copR YP_002008600.1 response regulator in two-component regulatory system with cops, regulation of copper resistance VFG1386 Protein 2e-22 41