Gene Information

Name : cce_0817 (cce_0817)
Accession : YP_001802234.1
Strain :
Genome accession: NC_010546
Putative virulence/resistance : Resistance
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 831821 - 832498 bp
Length : 678 bp
Strand : +
Note : -

DNA sequence :
ATGAGTAACCCCTGTATTTTAGTGGTTGAAGATGAAGTCAAACTAGCTCAGTTTATTGAATTAGAACTGAAATATGAAGG
CTATACAGTGACAGTGGTTAATGATGGGTTATCGGGACTAACCACAGCAAGAGAAAGCAACCCCGACCTCATTTTATTAG
ATTGGATGTTACCAGGCATTTCAGGACTCGACATTTGTAAACGACTGCGACAAACCGGAAGTAAAGTCCCCATTATCTTA
TTAACGGCTAAAGATGATATCAGCGATCGTGTGGCAGGTTTGGATGCAGGGGCCGATGATTATATCGTTAAACCTTTTAA
TCTAGAAGAATTATTAGCCAGAGTTCGGGCCAATTTAAGGCGAAATCATGAAGAAGATCCCGATCTTTTGCAATTTTTAG
ACCTTAGTTTAAATCGTAATACCCGTGAAGTGTTTCGGGGTAGTCGTTTGATTGAACTAACGGCCAAAGAGTTCGACTTA
CTAGAATATTTAATGTCTCATCCTAAACAAGTCCTCAGTCGAGATCAAATTTTAGAAAGGGTTTGGGGTTATGACTTTAT
GGGAGATTCTAATATTATTGAGGTTTATGTGCGTTATTTACGGTTAAAATTAGAAGCTGAACAAGAAAAACGACTGATCC
AAACCGTTCGAGGTGTGGGTTATGTCTTACGAGACTAG

Protein sequence :
MSNPCILVVEDEVKLAQFIELELKYEGYTVTVVNDGLSGLTTARESNPDLILLDWMLPGISGLDICKRLRQTGSKVPIIL
LTAKDDISDRVAGLDAGADDYIVKPFNLEELLARVRANLRRNHEEDPDLLQFLDLSLNRNTREVFRGSRLIELTAKEFDL
LEYLMSHPKQVLSRDQILERVWGYDFMGDSNIIEVYVRYLRLKLEAEQEKRLIQTVRGVGYVLRD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-26 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 6e-26 42
nisR2 YP_006309922.1 NisR Not tested FWisland_1 Protein 6e-16 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
cce_0817 YP_001802234.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 2e-41 51
cce_0817 YP_001802234.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 2e-41 51
cce_0817 YP_001802234.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 2e-41 51
cce_0817 YP_001802234.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 2e-41 51
cce_0817 YP_001802234.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 2e-41 51
cce_0817 YP_001802234.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 2e-41 51
cce_0817 YP_001802234.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 2e-41 51
cce_0817 YP_001802234.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 2e-41 51
cce_0817 YP_001802234.1 two component transcriptional regulator AE015929.1.gene1106. Protein 4e-38 50
cce_0817 YP_001802234.1 two component transcriptional regulator HE999704.1.gene1528. Protein 4e-44 50
cce_0817 YP_001802234.1 two component transcriptional regulator AE000516.2.gene3505. Protein 3e-41 49
cce_0817 YP_001802234.1 two component transcriptional regulator BAC0125 Protein 9e-36 46
cce_0817 YP_001802234.1 two component transcriptional regulator BAC0083 Protein 5e-33 46
cce_0817 YP_001802234.1 two component transcriptional regulator BAC0111 Protein 2e-32 46
cce_0817 YP_001802234.1 two component transcriptional regulator BAC0308 Protein 3e-34 45
cce_0817 YP_001802234.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 5e-36 45
cce_0817 YP_001802234.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 8e-36 45
cce_0817 YP_001802234.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 7e-36 45
cce_0817 YP_001802234.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 8e-36 45
cce_0817 YP_001802234.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 8e-36 45
cce_0817 YP_001802234.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 8e-36 45
cce_0817 YP_001802234.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 8e-36 45
cce_0817 YP_001802234.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 6e-36 45
cce_0817 YP_001802234.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 8e-36 45
cce_0817 YP_001802234.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 8e-36 45
cce_0817 YP_001802234.1 two component transcriptional regulator BAC0197 Protein 2e-33 45
cce_0817 YP_001802234.1 two component transcriptional regulator BAC0347 Protein 2e-31 44
cce_0817 YP_001802234.1 two component transcriptional regulator NC_002516.2.879194.p Protein 2e-22 42
cce_0817 YP_001802234.1 two component transcriptional regulator NC_012469.1.7685629. Protein 1e-30 41
cce_0817 YP_001802234.1 two component transcriptional regulator HE999704.1.gene2815. Protein 4e-34 41
cce_0817 YP_001802234.1 two component transcriptional regulator CP001918.1.gene3444. Protein 6e-25 41
cce_0817 YP_001802234.1 two component transcriptional regulator CP001918.1.gene5135. Protein 1e-12 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
cce_0817 YP_001802234.1 two component transcriptional regulator VFG1390 Protein 8e-48 53
cce_0817 YP_001802234.1 two component transcriptional regulator VFG1386 Protein 2e-42 43
cce_0817 YP_001802234.1 two component transcriptional regulator VFG0596 Protein 5e-27 42
cce_0817 YP_001802234.1 two component transcriptional regulator VFG1389 Protein 1e-34 41