Gene Information

Name : BamMC406_0123 (BamMC406_0123)
Accession : YP_001806841.1
Strain :
Genome accession: NC_010551
Putative virulence/resistance : Resistance
Product : MerR family transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 142718 - 143149 bp
Length : 432 bp
Strand : -
Note : TIGRFAM: Cd(II)/Pb(II)-responsive transcriptional regulator; PFAM: regulatory protein MerR; Transcription regulator MerR DNA binding; KEGG: bam:Bamb_0113 transcriptional regulator, MerR family

DNA sequence :
ATGAAGATCGGCGAATTGGCCAAGGCGGCCCGCTGCACGCCCGAAACGATCCGTTTCTACGAGCGCGAGGGGCTGATGCC
CGATGCGGAGCGCACCGATGCGAACTACCGCAACTACACCGACGTGCACGTCGAACGGCTGCGCTTCATCCGCAACTGCC
GCGCGCTCGACATGGCGCACGACGAAATCCGCACGCTGCTGCAGCTCACCGACAGCCCGGCCGACCCGTGCGATTCGGTC
AACACGCTGCTCGACGAGCACATCGGCCACGTCGATGCGCGCCTCGCCGAACTGACGCATCTGCGCGACCAGCTCACCGA
ATTGCGCCGCCAGTGCGTCGGAGAACATTCGGTGGAGGATTGCGGAATCGTGCATGGTCTCGCGACCATGGAAACCGTCG
CGCCGGCCGCGAAGCGCTCGCACCTCGGCTGA

Protein sequence :
MKIGELAKAARCTPETIRFYEREGLMPDAERTDANYRNYTDVHVERLRFIRNCRALDMAHDEIRTLLQLTDSPADPCDSV
NTLLDEHIGHVDARLAELTHLRDQLTELRRQCVGEHSVEDCGIVHGLATMETVAPAAKRSHLG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
ORF C98 AAN62191.1 putative transcriptional regulator Not tested PAGI-2(C) Protein 8e-32 50
ACICU_00234 YP_001844893.1 transcriptional regulator Not tested AbaR20 Protein 6e-30 47
cadR AGK36653.1 MerR family transcriptional regulator Not tested AbaR26 Protein 4e-30 47
cadR ACN81029.1 MerR family transcriptional regulator Not tested AbaR5 Protein 6e-30 47
pbrR CAJ77094.1 Transcriptional regulator Not tested AbaR1 Protein 4e-30 47
cadR ACS32041.1 MerR family transcriptional regulator Not tested AbaR5 Protein 1e-29 46
cadR ADZ05769.1 MerR family transcriptional regulator Not tested AbaR11 Protein 1e-29 46
pbrR CAJ77021.1 transcription regulator Not tested AbaR1 Protein 9e-30 46

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BamMC406_0123 YP_001806841.1 MerR family transcriptional regulator BAC0058 Protein 1e-39 58
BamMC406_0123 YP_001806841.1 MerR family transcriptional regulator BAC0301 Protein 6e-31 53