Gene Information

Name : Exig_3031 (Exig_3031)
Accession : YP_001815493.1
Strain : Exiguobacterium sibiricum 255-15
Genome accession: NC_010556
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3015363 - 3016073 bp
Length : 711 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: bld:BLi04335 YycF

DNA sequence :
GTGACGGAACGTAAAATCCTCGTCGTCGATGACGAGCAACCGATTGCCGATATATTAAAATTTAAATTAGAAAAAGAAGG
TTATAGTGTCGCCGTAGCAAATGATGGAGTGGAAGCACTCGAGAAAGTCGAAGAGTTCAATCCCGATTTGATTTTGCTGG
ATATCATGTTGCCCTTGATGGATGGCATGGAAGTTTGCCGGGAAGTCCGGAAAACTTCAAAAGTTCCGATCATCATGCTG
ACAGCAAAGGATTCCGAAATCGATACGGTCCTTGGCCTTGAGCTTGGTGCCAATGATTACGTCACGAAGCCATTCAGCTC
ACGCGAATTATTAGCACGCGTGAAGGCACATTTGCGGAACGTCAATACCGTCGAAGCGGCACCTGCCAATGCAGGACCGG
GTCCGCTCAAAGTAGGAGAACTGTATATCGATACGAATTCTCATACCGTTACACGACAAGATCAAAAAATCGAGCTGACG
CAACGTGAGTTTGAACTGTTGCATTACTTGGCAAAAAATATCGGGCAAGTCATGACCCGGGAACACTTGCTTCAAACAGT
CTGGGGATACGACTACTTCGGTGATGTACGGACCGTCGACGTCACAGTGCGCCGTCTGCGTGAAAAAGTCGAAGACAACC
CGAGTACACCAATCTATATCATGACCCGCCGCGGTGTCGGCTACTATCTCCAAGACGGGGAGAATGAATAA

Protein sequence :
MTERKILVVDDEQPIADILKFKLEKEGYSVAVANDGVEALEKVEEFNPDLILLDIMLPLMDGMEVCREVRKTSKVPIIML
TAKDSEIDTVLGLELGANDYVTKPFSSRELLARVKAHLRNVNTVEAAPANAGPGPLKVGELYIDTNSHTVTRQDQKIELT
QREFELLHYLAKNIGQVMTREHLLQTVWGYDYFGDVRTVDVTVRRLREKVEDNPSTPIYIMTRRGVGYYLQDGENE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-22 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-21 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Exig_3031 YP_001815493.1 two component transcriptional regulator NC_012469.1.7685629. Protein 2e-54 61
Exig_3031 YP_001815493.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 6e-43 54
Exig_3031 YP_001815493.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 5e-43 52
Exig_3031 YP_001815493.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 8e-43 52
Exig_3031 YP_001815493.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 8e-43 52
Exig_3031 YP_001815493.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 8e-43 52
Exig_3031 YP_001815493.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 8e-43 52
Exig_3031 YP_001815493.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 8e-43 52
Exig_3031 YP_001815493.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 8e-43 52
Exig_3031 YP_001815493.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 6e-43 52
Exig_3031 YP_001815493.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 8e-43 52
Exig_3031 YP_001815493.1 two component transcriptional regulator HE999704.1.gene2815. Protein 1e-36 49
Exig_3031 YP_001815493.1 two component transcriptional regulator NC_012469.1.7686381. Protein 8e-37 48
Exig_3031 YP_001815493.1 two component transcriptional regulator HE999704.1.gene1528. Protein 1e-27 46
Exig_3031 YP_001815493.1 two component transcriptional regulator AE016830.1.gene1681. Protein 8e-39 46
Exig_3031 YP_001815493.1 two component transcriptional regulator AE000516.2.gene3505. Protein 1e-33 46
Exig_3031 YP_001815493.1 two component transcriptional regulator CP004022.1.gene3215. Protein 1e-28 46
Exig_3031 YP_001815493.1 two component transcriptional regulator CP001138.1.gene4273. Protein 4e-28 46
Exig_3031 YP_001815493.1 two component transcriptional regulator BAC0533 Protein 3e-28 46
Exig_3031 YP_001815493.1 two component transcriptional regulator CP000647.1.gene4257. Protein 3e-28 46
Exig_3031 YP_001815493.1 two component transcriptional regulator CP000034.1.gene3834. Protein 8e-28 45
Exig_3031 YP_001815493.1 two component transcriptional regulator NC_002695.1.915041.p Protein 8e-28 45
Exig_3031 YP_001815493.1 two component transcriptional regulator FJ349556.1.orf0.gene Protein 6e-30 44
Exig_3031 YP_001815493.1 two component transcriptional regulator AF155139.2.orf0.gene Protein 9e-29 43
Exig_3031 YP_001815493.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 5e-27 43
Exig_3031 YP_001815493.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 5e-27 43
Exig_3031 YP_001815493.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 5e-27 43
Exig_3031 YP_001815493.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 5e-27 43
Exig_3031 YP_001815493.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 5e-27 43
Exig_3031 YP_001815493.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 5e-27 43
Exig_3031 YP_001815493.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 5e-27 43
Exig_3031 YP_001815493.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 5e-27 43
Exig_3031 YP_001815493.1 two component transcriptional regulator CP000647.1.gene2531. Protein 3e-24 43
Exig_3031 YP_001815493.1 two component transcriptional regulator BAC0125 Protein 3e-25 42
Exig_3031 YP_001815493.1 two component transcriptional regulator NC_014475.1.orf0.gen Protein 1e-30 41
Exig_3031 YP_001815493.1 two component transcriptional regulator NC_005054.2598277.p0 Protein 1e-30 41
Exig_3031 YP_001815493.1 two component transcriptional regulator AF162694.1.orf4.gene Protein 3e-25 41
Exig_3031 YP_001815493.1 two component transcriptional regulator AE015929.1.gene1106. Protein 2e-24 41
Exig_3031 YP_001815493.1 two component transcriptional regulator CP001918.1.gene3444. Protein 7e-23 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Exig_3031 YP_001815493.1 two component transcriptional regulator VFG0596 Protein 2e-22 43
Exig_3031 YP_001815493.1 two component transcriptional regulator VFG1390 Protein 6e-32 43
Exig_3031 YP_001815493.1 two component transcriptional regulator VFG1389 Protein 8e-22 42