Gene Information

Name : Oter_1727 (Oter_1727)
Accession : YP_001818611.1
Strain : Opitutus terrae PB90-1
Genome accession: NC_010571
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2125319 - 2126005 bp
Length : 687 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: mag:amb2895 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
ATGGCCGTGAACACCATGCGCGTGCTCGTCGTCGAAGATGACGCCAAGATTTCCTCCTTCGTGGTCAAGGGCCTGAAGCA
GGAAGGTTATGCCGTGGACCACGCGCCCGACGGCGACACCGGACTCGCGCTCGCGACCTCGACGGCCTACGACGCGGCGG
TCGTCGACATCATGCTGCCGGAGCTGGATGGGCTCAGCCTGGTGCGGCGACTCCGCGCCGAGCGCAGCGCAATGCCGGTC
CTGTTTTTGAGCGCCCGTGCCAGCGTCGAAGATCGCGTGAAGGGATTGCAGGCCGGCGGCGACGATTATCTGACCAAGCC
TTTCGCGTTTGCCGAGCTCTCGGCCCGGCTGCAGGCGCTGATCCGACGCGCCTCACGCTCGCCCGAGGCGACGCGGCTGA
GTGCAGGCGATGTCACGCTCGATCTGGTTTCGCGCACGGTCACCGTCGGCGGCCAGCCGGTGGAACTGCAGCCGCGGGAA
TTCTCGTTGTTGGAATACCTGCTGCGACACGCCGGCCGGCCCGTGACGAAAGTCATGATTCTCGAGCACGTCTGGGACTA
CAGCTTTGATCCGCAGACCAATGTGGTCGACGTGTTGATGTCGCGGCTGCGAAGCAAAATTGATCCGGACAAGACGCGGA
TCGAAACGCTGCGAGGAGTGGGTTATGTCTTCAAAGCCGGCCGTTGA

Protein sequence :
MAVNTMRVLVVEDDAKISSFVVKGLKQEGYAVDHAPDGDTGLALATSTAYDAAVVDIMLPELDGLSLVRRLRAERSAMPV
LFLSARASVEDRVKGLQAGGDDYLTKPFAFAELSARLQALIRRASRSPEATRLSAGDVTLDLVSRTVTVGGQPVELQPRE
FSLLEYLLRHAGRPVTKVMILEHVWDYSFDPQTNVVDVLMSRLRSKIDPDKTRIETLRGVGYVFKAGR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-41 46
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 9e-41 45

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Oter_1727 YP_001818611.1 two component transcriptional regulator BAC0125 Protein 3e-46 46
Oter_1727 YP_001818611.1 two component transcriptional regulator BAC0083 Protein 9e-49 46
Oter_1727 YP_001818611.1 two component transcriptional regulator BAC0347 Protein 6e-48 46
Oter_1727 YP_001818611.1 two component transcriptional regulator BAC0111 Protein 1e-50 46
Oter_1727 YP_001818611.1 two component transcriptional regulator BAC0308 Protein 4e-44 46
Oter_1727 YP_001818611.1 two component transcriptional regulator BAC0638 Protein 4e-42 46
Oter_1727 YP_001818611.1 two component transcriptional regulator BAC0197 Protein 2e-44 46
Oter_1727 YP_001818611.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 2e-36 41
Oter_1727 YP_001818611.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 2e-36 41
Oter_1727 YP_001818611.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 2e-36 41
Oter_1727 YP_001818611.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 2e-36 41
Oter_1727 YP_001818611.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 2e-36 41
Oter_1727 YP_001818611.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 2e-36 41
Oter_1727 YP_001818611.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 2e-36 41
Oter_1727 YP_001818611.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 2e-36 41
Oter_1727 YP_001818611.1 two component transcriptional regulator BAC0487 Protein 2e-35 41
Oter_1727 YP_001818611.1 two component transcriptional regulator NC_002516.2.879194.p Protein 3e-37 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Oter_1727 YP_001818611.1 two component transcriptional regulator VFG0596 Protein 5e-42 46
Oter_1727 YP_001818611.1 two component transcriptional regulator VFG1386 Protein 4e-45 46
Oter_1727 YP_001818611.1 two component transcriptional regulator VFG1389 Protein 7e-36 44
Oter_1727 YP_001818611.1 two component transcriptional regulator VFG1390 Protein 1e-40 43