Gene Information

Name : SGR_4049 (SGR_4049)
Accession : YP_001825561.1
Strain : Streptomyces griseus NBRC 13350
Genome accession: NC_010572
Putative virulence/resistance : Resistance
Product : TerD-family protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 4739000 - 4739575 bp
Length : 576 bp
Strand : -
Note : -

DNA sequence :
ATGGCAGTAAGCCTGTCCAAGGGCGGCAACGTCTCGCTCACCAAGGAGGCACCGGGCCTTACCGCCGTCACGGTCGGCCT
CGGCTGGGACGTCCGCACCACCACCGGCACCGACTTCGACCTCGACGCCTCGGCGATCGCGGTCAACGCGGGCGGAAAGG
TCGTCTCGGACGGCCACTTCGTCTTCTTCAACAACAAGTCGACGCCGGACCAGACCATCGTGCACACCGGTGACAACGTC
ACGGGTGAGGGCGAGGGCGACGACGAGCAGATCAACGTCAACCTGGCGGGCCTGCCGGCCGACGTGGACAAGATCGTCTT
CCCGGTCTCCATCTACGACGCCGAGAACCGCAGCCAGAACTTCGGCCAGGTCCGGAACGCGTTCATCCGCATCCTCAACC
AGGCCGGCGGCGCCGAGATCGCCCGCTACGACCTGAGCGAGGACGCCGCCACCGAGACCGCCATGGTCTTCGGCGAGCTC
TACCGCAACGGCGCCGAGTGGAAGTTCCGCGCGGTCGGCCAGGGGTACGCCTCCGGCCTGCGCGGCATCGCCCAGGACTT
CGGCGTCAACCTCTGA

Protein sequence :
MAVSLSKGGNVSLTKEAPGLTAVTVGLGWDVRTTTGTDFDLDASAIAVNAGGKVVSDGHFVFFNNKSTPDQTIVHTGDNV
TGEGEGDDEQINVNLAGLPADVDKIVFPVSIYDAENRSQNFGQVRNAFIRILNQAGGAEIARYDLSEDAATETAMVFGEL
YRNGAEWKFRAVGQGYASGLRGIAQDFGVNL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 8e-60 65
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-59 65
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-59 65
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-58 64
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 8e-59 64
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-57 60
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-57 60
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 5e-57 59
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 2e-30 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SGR_4049 YP_001825561.1 TerD-family protein BAC0390 Protein 2e-58 62
SGR_4049 YP_001825561.1 TerD-family protein BAC0389 Protein 2e-56 60