Gene Information

Name : Bind_3413 (Bind_3413)
Accession : YP_001834459.1
Strain : Beijerinckia indica ATCC 9039
Genome accession: NC_010581
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3872219 - 3872977 bp
Length : 759 bp
Strand : +
Note : TIGRFAM: phosphate regulon transcriptional regulatory protein PhoB; PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: xau:Xaut_0202 two component transcriptional regulator, winged helix family

DNA sequence :
ATGAACCAGACAGCAGAGGTTTCCAGCAAGAGCAGCAATTCCGCGCGCAACAAAACATCGACCGCGACGACGCGCATTCT
CCTCGTCGAGGACGAGGCCGCTTTGAGCACACTGCTCACCTATAATCTCGAGGCCGAGGGCTTCGAGGTCGAGAGCCTTG
AGTGCGGCGACGAGGCCGAGGCCCGTCTCGATGAAAGCCTGCCTGATCTCGTCCTTCTCGACTGGATGCTGCCCGGTGTC
TCCGGCCTTGAAATCTGCCGCCGCATCCGTGCGCGCGAGAAGACACGGGCGCTGCCGATCATCATGCTGACGGCGCGCGG
CGAGGAAAGCGAAAAGATCCGGGGGCTCGCGACGGGCGCCGATGATTATATCGTCAAGCCTTTCTCGGTGCCCGAATTGA
TGGCGCGTGTCCGCGCCCTGTTGCGCCGCTCGCGACCAGACCGTATCACCGGCCTGCTCACCGCCGGTGATCTCTCACTC
GATCGGGAGAATTGGCGTGTCCATCGCGGCGAGCGGCATGTCCATCTCGGACCGACCGAATTCCGCCTGCTCGATCATCT
GATGGGCCGGCCAGGCCGCGTCTTTTCCCGCGCGCAATTGCTGGACGGCGTCTGGGGCGAGGCGGCGGAGATCGACGAGC
GCACCGTCGATGTCCATGTCGGGCGCCTGCGCAAGGCCTTGTCGATCGGCGAGGAACAGGACCCCATCCGCACGGTGCGC
GGCGCCGGCTATTCCTTCGACGAGCATTTCGGCAAATAA

Protein sequence :
MNQTAEVSSKSSNSARNKTSTATTRILLVEDEAALSTLLTYNLEAEGFEVESLECGDEAEARLDESLPDLVLLDWMLPGV
SGLEICRRIRAREKTRALPIIMLTARGEESEKIRGLATGADDYIVKPFSVPELMARVRALLRRSRPDRITGLLTAGDLSL
DRENWRVHRGERHVHLGPTEFRLLDHLMGRPGRVFSRAQLLDGVWGEAAEIDERTVDVHVGRLRKALSIGEEQDPIRTVR
GAGYSFDEHFGK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 3e-37 44
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-36 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bind_3413 YP_001834459.1 two component transcriptional regulator AE000516.2.gene3505. Protein 2e-34 44
Bind_3413 YP_001834459.1 two component transcriptional regulator AE016830.1.gene1681. Protein 1e-36 42
Bind_3413 YP_001834459.1 two component transcriptional regulator HE999704.1.gene2815. Protein 3e-38 42
Bind_3413 YP_001834459.1 two component transcriptional regulator BAC0596 Protein 3e-37 42
Bind_3413 YP_001834459.1 two component transcriptional regulator BAC0039 Protein 3e-37 42
Bind_3413 YP_001834459.1 two component transcriptional regulator CP001918.1.gene3444. Protein 4e-38 42
Bind_3413 YP_001834459.1 two component transcriptional regulator CP001138.1.gene2239. Protein 3e-37 42
Bind_3413 YP_001834459.1 two component transcriptional regulator CP000034.1.gene2186. Protein 3e-37 42
Bind_3413 YP_001834459.1 two component transcriptional regulator NC_002695.1.916589.p Protein 2e-37 42
Bind_3413 YP_001834459.1 two component transcriptional regulator NC_002516.2.879194.p Protein 6e-32 41
Bind_3413 YP_001834459.1 two component transcriptional regulator NC_012469.1.7685629. Protein 1e-35 41
Bind_3413 YP_001834459.1 two component transcriptional regulator CP000647.1.gene2531. Protein 8e-39 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bind_3413 YP_001834459.1 two component transcriptional regulator VFG1702 Protein 1e-37 44
Bind_3413 YP_001834459.1 two component transcriptional regulator VFG1563 Protein 1e-36 43
Bind_3413 YP_001834459.1 two component transcriptional regulator VFG1390 Protein 1e-37 42