Gene Information

Name : LAF_0015 (LAF_0015)
Accession : YP_001842831.1
Strain : Lactobacillus fermentum IFO 3956
Genome accession: NC_010610
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 16335 - 17042 bp
Length : 708 bp
Strand : +
Note : -

DNA sequence :
ATGGCCAAGAAAGTTTTGGTTGTTGACGATGAAAAACCGATTTCGGATATCATTAAGTTTAACCTAGAAAAGGAGGGCTA
TGAAGTCGTCGTGGCTTACGACGGGGAAGAGGCCCTGCAAAAGGTCGAAAGCGAGTCACCGGATCTGATCGTCTTAGACC
TGATGCTGCCCAAAATTGACGGCCTGGAAGTGGCTAAGCAGGTGCGGGCTAAGCGTTCGACGCCAATCATCATGGTAACG
GCTAAGGATTCGGAACTCGATAAGGTTTTGGGCCTTGAGTTGGGGGCCGACGATTACGTTACCAAGCCGTTTTCTAACCG
TGAGCTAGTGGCCCGGGTTAAGGCTAACCTGCGCCGCCAAGACGCCACCGTTTCACCGGCGAACGACGACCGGACCGCCG
ATATCAAGGTGGGGGATTTGACCATCCACCCGGACGCCTACACGGTCACCAAGCGGGGCGAAAACATCAACCTGACCCAC
CGGGAGTTCGAGCTCTTGCACTACCTCGCCCAACACATTGGCCAGGTCATCAACCGGGAGCACCTCTTGCAAACGGTGTG
GGGCTACGATTACTTTGGTGACGTCCGGACCGTTGACGTAACGGTGCGCCGGTTGCGTGAAAAAATCGAAGATAACCCGA
GTCACCCCCAGTGGCTGATCACGCGGCGGGGGGTCGGTTACTACCTAGCCAACCCGAATCAGGATTAA

Protein sequence :
MAKKVLVVDDEKPISDIIKFNLEKEGYEVVVAYDGEEALQKVESESPDLIVLDLMLPKIDGLEVAKQVRAKRSTPIIMVT
AKDSELDKVLGLELGADDYVTKPFSNRELVARVKANLRRQDATVSPANDDRTADIKVGDLTIHPDAYTVTKRGENINLTH
REFELLHYLAQHIGQVINREHLLQTVWGYDYFGDVRTVDVTVRRLREKIEDNPSHPQWLITRRGVGYYLANPNQD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 6e-34 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 4e-34 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
LAF_0015 YP_001842831.1 two-component response regulator NC_012469.1.7685629. Protein 4e-69 70
LAF_0015 YP_001842831.1 two-component response regulator NC_013450.8614421.p0 Protein 5e-58 57
LAF_0015 YP_001842831.1 two-component response regulator NC_002952.2859905.p0 Protein 1e-57 57
LAF_0015 YP_001842831.1 two-component response regulator NC_007793.3914279.p0 Protein 5e-58 57
LAF_0015 YP_001842831.1 two-component response regulator NC_003923.1003749.p0 Protein 6e-58 57
LAF_0015 YP_001842831.1 two-component response regulator NC_002745.1124361.p0 Protein 5e-58 57
LAF_0015 YP_001842831.1 two-component response regulator NC_009782.5559369.p0 Protein 5e-58 57
LAF_0015 YP_001842831.1 two-component response regulator NC_002951.3237708.p0 Protein 5e-58 57
LAF_0015 YP_001842831.1 two-component response regulator NC_002758.1121668.p0 Protein 5e-58 57
LAF_0015 YP_001842831.1 two-component response regulator NC_009641.5332272.p0 Protein 5e-58 57
LAF_0015 YP_001842831.1 two-component response regulator NC_007622.3794472.p0 Protein 7e-58 56
LAF_0015 YP_001842831.1 two-component response regulator HE999704.1.gene2815. Protein 3e-50 54
LAF_0015 YP_001842831.1 two-component response regulator NC_012469.1.7686381. Protein 8e-44 50
LAF_0015 YP_001842831.1 two-component response regulator AE016830.1.gene1681. Protein 2e-45 48
LAF_0015 YP_001842831.1 two-component response regulator FJ349556.1.orf0.gene Protein 3e-41 47
LAF_0015 YP_001842831.1 two-component response regulator NC_007793.3914065.p0 Protein 9e-38 45
LAF_0015 YP_001842831.1 two-component response regulator NC_002758.1121390.p0 Protein 9e-38 45
LAF_0015 YP_001842831.1 two-component response regulator NC_010079.5776364.p0 Protein 9e-38 45
LAF_0015 YP_001842831.1 two-component response regulator NC_002952.2859858.p0 Protein 9e-38 45
LAF_0015 YP_001842831.1 two-component response regulator NC_007622.3794948.p0 Protein 9e-38 45
LAF_0015 YP_001842831.1 two-component response regulator NC_003923.1003417.p0 Protein 9e-38 45
LAF_0015 YP_001842831.1 two-component response regulator NC_013450.8614146.p0 Protein 9e-38 45
LAF_0015 YP_001842831.1 two-component response regulator NC_002951.3238224.p0 Protein 9e-38 45
LAF_0015 YP_001842831.1 two-component response regulator AE000516.2.gene3505. Protein 6e-35 44
LAF_0015 YP_001842831.1 two-component response regulator AF155139.2.orf0.gene Protein 1e-38 44
LAF_0015 YP_001842831.1 two-component response regulator AE015929.1.gene1106. Protein 2e-31 44
LAF_0015 YP_001842831.1 two-component response regulator CP001918.1.gene5135. Protein 5e-31 43
LAF_0015 YP_001842831.1 two-component response regulator NC_002695.1.915041.p Protein 3e-35 43
LAF_0015 YP_001842831.1 two-component response regulator CP000034.1.gene3834. Protein 3e-35 43
LAF_0015 YP_001842831.1 two-component response regulator CP004022.1.gene3215. Protein 5e-38 43
LAF_0015 YP_001842831.1 two-component response regulator CP001138.1.gene4273. Protein 3e-35 42
LAF_0015 YP_001842831.1 two-component response regulator AM180355.1.gene1830. Protein 5e-38 42
LAF_0015 YP_001842831.1 two-component response regulator AF162694.1.orf4.gene Protein 9e-37 42
LAF_0015 YP_001842831.1 two-component response regulator HE999704.1.gene1528. Protein 2e-29 42
LAF_0015 YP_001842831.1 two-component response regulator BAC0533 Protein 6e-35 41
LAF_0015 YP_001842831.1 two-component response regulator CP000647.1.gene4257. Protein 6e-35 41
LAF_0015 YP_001842831.1 two-component response regulator DQ212986.1.gene4.p01 Protein 3e-38 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
LAF_0015 YP_001842831.1 two-component response regulator VFG1389 Protein 1e-30 43
LAF_0015 YP_001842831.1 two-component response regulator VFG1563 Protein 4e-34 41
LAF_0015 YP_001842831.1 two-component response regulator VFG1702 Protein 2e-34 41